DLI Downloader 0.2 - Sanskrit Books Catalogue

Availability of books at the DLI, IIIT as of July 2010

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  

Key:  Green: Available.  Red: No copy.  Maroon: DLI may have a copy. May be available soon.   Fuchsia: No information.

These catalogues and the DLI Downloader 0.2 are freeware. © Prabhu, P.R. Labs 2010. Contact: dli.downloader@yahoo.com

A


1. A Bibliography Of The Sanskrit Drama  Schuyler Montgomery; Drama, 1906, The Columbia University Press, 120 pages. Barcode 2030020002236   Scan available.

2. A Catalogue Of Sanskrit And Prakrit Manuscripts In The Rajasthan Oriental Research Institute Part Iii A  Muni Jinavijaya; Unknown, 1967, The_Rajasthan_Oriental_Research_Institute, 626 pages. Barcode 2020010003761   Scan available.

3. A Catalogue Of Sanskrit Manuscripts No 1  T Ganapati Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1912, The Authority Of The Government Of His Highness The Maharaja Of Travancore, 200 pages. Barcode 5010010078069   Scan available.

4. A Cattalouge Of The Sanskrit Manuscripts  Dr.aryendra Sharma; Unknown, 1964, The_Sanskrit_Academy,osmaia_University, 338 pages. Barcode 2020010003763   Scan available.

5. A Comparative Grammar Of The Sanskrit Zend Vol Ii  Eastwick Edward B; Language. Linguistics. Literature, 1862, Williams And Norgate, 499 pages. Barcode 2030020005565   Scan available.

6. A Comparative Grammer Of The Sanskrit Vol Ii  Bopp F Professor; Languages, Linguistics, 1862, Willaims And Norgate, 505 pages. Barcode 2030020005030   Scan available.

7. A Comprehensive Grammar Of The Sanskrit Language Vol Iii Part I  Prakasha; LANGUAGE. LINGUISTICS. LITERATURE, 1884, T.P.Brothers , Calcutta, 712 pages. Barcode 5010010042303   Scan not available.

8. a Consolidated Glossary Of Technical Terms  p.padmanaabha; Language. Linguistics. Literature, 0, the zodiac press, 740 pages. Barcode 2020050058044   Scan not available.

9. A Critique Of The Brahmasutra Part 1  P M Modi; Unknown, 999, P_M_Modi, 530 pages. Barcode 2020010003770   Scan available.

10. A Critique Of The Brahmasutra Part 2  P M Modi; Unknown, 1956, P_M_Modi, 422 pages. Barcode 2020010003771   Scan not available.

11. A Descriptive Caralogue Of The Sanskrit Manuscripts Volume X Systems Of Indian Philosophy Dvaitavendnta Visistadvaita Vedanta And Saiva Vedanta  M Rangacharya Ma Rao Bahadur; Religion, 1911, The Superintendent Government Press, 382 pages. Barcode 5010010004366   Server error, availability unknown.

12. A Descriptive Caralogue Of The Sanskrit Manuscripts Volume Xii Religion  M Rangacharya Ma Rao Bahadur; Religion, 1912, The Superintendent Government Press, 458 pages. Barcode 5010010004365   Server error, availability unknown.

13. A Descriptive Catalogue Of Sanskrit Manuscripts ,vol Vii Dharma Sastra  M Rangacharya; LANGUAGE. LINGUISTICS. LITERATURE, 1909, The Superintendent ,Government Press , Madras, 376 pages. Barcode 5010010078036   Scan available.

14. A Descriptive Catalogue Of Sanskrit Manuscripts ,vol X  M Rangacharya; LANGUAGE. LINGUISTICS. LITERATURE, 1911, The Superintendent Government Press, Madras, 382 pages. Barcode 5010010078057   Scan available.

15. A Descriptive Catalogue Of Sanskrit Manuscripts Vol I Part Iii  M. Sesha Giri Sastry and M. Ranga Charya; Religion, 1905, Government Of Madras, 350 pages. Barcode 5010010004395   Server error, availability unknown.

16. A Descriptive Catalogue of Sanskrit Manuscripts Vol Xvi  M. Ranga Charya and S. Kuppu Swamy Sastry; Religion, 1914, Government of Madras, 502 pages. Barcode 5010010004384   Server error, availability unknown.

17. A Descriptive Catalogue Of Sanskrit Manuscripts Volume I Part Ii  T P Upadhyaya; Religion, 1953, Shri Vishweswar Press Banaras, 266 pages. Barcode 5010010004369   Server error, availability unknown.

18. A Descriptive Catalogue Of the Sanskrit Manuscript Volume Iv  M. Rangacharya; Religion, 1907, Government Press Madras, 430 pages. Barcode 5010010004375   Server error, availability unknown.

19. A Descriptive Catalogue Of the Sanskrit Manuscript Volume Vi  M. Rangacharya; Religion, 1909, Government Press Madras, 328 pages. Barcode 5010010004385   Server error, availability unknown.

20. A Descriptive Catalogue Of The Sanskrit Manuscripts  P P S Sastri; Unknown, 1929, Sri_Vani_Vilas_Press, 530 pages. Barcode 2020010003779   Scan available.

21. A Descriptive Catalogue Of The Sanskrit Manuscripts  Vidya Sagara; Unknown, 1934, Sri_Vani_Vilas_Press, 452 pages. Barcode 2020010003780   Scan available.

22. A Descriptive Catalogue Of The Sanskrit Manuscripts In The Govenment Oriental Manuscripts Library , Madras Vol Ii Vedic Literature  M Rangacharya Rao Bahadur; LANGUAGE. LINGUISTICS. LITERATURE, 1905, The Superintendent Government Press ,Madras, 344 pages. Barcode 5010010078072   Scan available.

23. A Descriptive Catalogue Of The Sanskrit Manuscripts In The Govenment Oriental Manuscripts Library, Madras Vol Vi Dharma Sastra  M Rangacharya; LANGUAGE. LINGUISTICS. LITERATURE, 1909, The Superintendent Government Press, Madras, 330 pages. Barcode 5010010078127   Scan available.

24. A Descriptive Catalogue Of The Sanskrit Manuscripts In The Government Oriental Manuscripts Library , Madras Vol 8 Arthasastra Kamasastra And Systems Of Indian Philosophy Nyaya  M Rangacharya; GEOGRAPHY. BIOGRAPHY. HISTORY, 1910, The Superintendent , Government Press, Madras, 313 pages. Barcode 5010010078040   Scan available.

25. A Descriptive Catalogue Of The Sanskrit Manuscripts In The Government Oriental Manuscripts Library , Madras Vol Xviii Stotras Cont 2prasamsa Stotras  M Rangacharya; GEOGRAPHY. BIOGRAPHY. HISTORY, 1915, The Superintendent Government Press ,Madras, 582 pages. Barcode 5010010078146   Scan available.

26. A Descriptive Catalogue Of The Sanskrit Manuscripts In The Government Oriental Manuscripts Library ,madras , Vol 1 Vedic Literature Part 3  M Rangacharya; GEOGRAPHY. BIOGRAPHY. HISTORY, 1905, The Superintendent , Government Press, Madras, 349 pages. Barcode 5010010078133   Scan available.

27. A Descriptive Catalogue Of The Sanskrit Manuscripts In The Government Oriental Manuscripts Library ,madras , Vol 22  S Kuppuswami Sastri; GEOGRAPHY. BIOGRAPHY. HISTORY, 1918, The Superintendent , Government Press, Madras, 206 pages. Barcode 5010010078110   Scan available.

28. A Descriptive Catalogue Of The Sanskrit Manuscripts In The Government Oriental Manuscripts Library ,madras , Vol 5 Dharma Sastra  M Rangacharya; GEOGRAPHY. BIOGRAPHY. HISTORY, 1909, The Superintendent , Government Press, Madras, 378 pages. Barcode 5010010078093   Scan available.

29. A Descriptive Catalogue Of The Sanskrit Manuscripts Vo Iii  P P S Sastri; Unknown, 1929, Sri_Vani_Vilas_Press, 632 pages. Barcode 2020010003777   Scan available.

30. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol 14  Tanjore Maharaja Serfoji S; Unknown, 1932, Sri_Vani_Vilas_Press, 523 pages. Barcode 2020010003778   Scan available.

31. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol Iii  M.Rangacharya; LANGUAGE. LINGUISTICS. LITERATURE, 1906, The Superintendent Government Press , Madras, 356 pages. Barcode 5010010078030   Scan available.

32. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol Iv Itihasa And Purana (First Part)  S Kuppuswami Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1907, The Superintendent Government Press, Madras, 378 pages. Barcode 5010010078087   Scan available.

33. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol Iv Upapuranas And Sthalamahatmyas  M Rangacharya Rao; LANGUAGE. LINGUISTICS. LITERATURE, 1908, The Superintendent Government Press, Madras, 342 pages. Barcode 5010010078004   Scan available.

34. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol Xiv  M Rangacharya; Religion, 1912, The Superintendent Government Press Madras, 426 pages. Barcode 5010010004381   Server error, availability unknown.

35. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol Xvii  M Rangacharya; Religion, 1914, The Superintendent Government Press Madras, 332 pages. Barcode 5010010004383   Server error, availability unknown.

36. A Descriptive Catalogue Of The Sanskrit Manustcripts Vol Xi Systems Of Indian Philosophy  M Rangacharya; LANGUAGE. LINGUISTICS. LITERATURE, 1911, The Superintendent Government Press, Madras, 440 pages. Barcode 5010010078135   Scan available.

37. A Descriptive Catalogue Of The Sanskrit Manustcripts Vol Xiii Religion  M Rangacharya; LANGUAGE. LINGUISTICS. LITERATURE, 1912, The Superintendent , Government Press, Madras, 432 pages. Barcode 5010010078071   Scan available.

38. A Descriptive Catalogue Of The Sanskrit Manustcripts Vol Xxiv Jyautisa  S Kuppuswami Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1918, The Superintendent , Government Press, Madras, 508 pages. Barcode 5010010078062   Scan available.

39. A Dictionary English And Sanskrit  sir monier monier williams; Unknown, 1957, akhila bharatiya sanskrit parishad, 666 pages. Barcode 2020010003794   Scan available.

40. A Dictionary Of Sanskrith Grammar  Kashinath Vasudev Abhyankar; Unknown, 1961, Oriental_Institute, 436 pages. Barcode 2020010003796   Scan available.

41. A Grammatical Dictonary Of Sanskrit Vedic  Surya Kanta Sastri; Unknown, 1953, Moolchand_Khairati_Ran_Trust, 308 pages. Barcode 2020010003826   Scan available.

42. A Grammatical Word Index To Atharvaveda  vishva bhandu; Unknown, 1963, vishveshvarananda vedic research insitute, 734 pages. Barcode 2020010003827   Scan available.

43. A Grammatical Word Index To Rigveda  Vishva Bhandhu; Unknown, 1963, Vishveshvaranand Vedic Research Institute, 648 pages. Barcode 2020010003828   Scan available.

44. A Grammatical Word Index To Taittiriya Samhita  vishva bhandu; Unknown, 1963, vishveshvarananda vedic research insitute, 376 pages. Barcode 2020010003829   Scan available.

45. A Grammatical Word Index To The Four Vedas  Vishva Bandhu; Unknown, 1963, VISHVESHARANANDA VEDIC RESEARCH INSITUTE, 506 pages. Barcode 2020010003830   Scan available.

46. A Grammatical Word Index To The Principle Upanisads  vishva bandhu; Unknown, 1966, vishveshvarananda vedic research insitute, 579 pages. Barcode 2020010003831   Scan available.

47. A Handful Of Popular Maxims  Dr.m.d.balasuramanyam; Unknown, 1983, Nirajana Publishers AND Booksellers, 336 pages. Barcode 2020010003842   Scan available.

48. A History Of Sanskrit Literature  Arthur A. Macdonell; Literature, 1905, LONDON: WILLIAM HEINEMANN, 482 pages. Barcode 2020010021391   Scan available.

49. A history Of Sanskrit Literature  A Macdonell; Language. Linguistics. Literature, 1900, William Heinemann, 468 pages. Barcode 2020050030942   Scan not available.

50. A History of The Classical Sanskrit Literature  M.krishnamacharya; Enter Subject Of The Book, 1906, The Vaijayanthi Press,  pages. Barcode 1990040027047   Server error, availability unknown.

51. a Sanskrit Composition And Translation Manual  pandit sarada prasad bidyabhushan; Language. Linguistics. Literature, 1932, ram naraian lal alahabad, 392 pages. Barcode 2020050036344   Scan not available.

52. A Sanskrit Grammar For Beginners  F.max Muller; Language, 1886, London Longmans Green And Company, 213 pages. Barcode 5010010005631   Server error, availability unknown.

53. a Sanskrit Primer  edward delavan perry; Language. Linguistics. Literature, 1950, columbia university press, 248 pages. Barcode 2020050036355   Scan not available.

54. a Sanskrit Reader  charles rockwell lanman; Language. Linguistics. Literature, 1888, ginn and company boston, 440 pages. Barcode 2020050036359   Scan not available.

55. A Sanskrit Reader With Vocabulary And Notes  Charles Rockwell Lanman; Literature, 1888, Ginn And Company, 438 pages. Barcode 130664   Server error, availability unknown.

56. A Short History Of Sanskrit Literarure  T K Ramachandra Iyer; Literature, 2002, R.S.Vadhyar amp Sons, 220 pages. Barcode 2020010010628   Server error, availability unknown.

57. A Short History Of Sanskrit Literature  Madhavadasa Chakravorti; Unknown, 1919, Upper Circular Road Calcutta, 500 pages. Barcode 5010010004551   Server error, availability unknown.

58. A Study Of Bharatas Natyasasatra And Avaloka On Dhananjayas Dasarupaka  Dr Manjula Gupta; Unknown, 1987, Gian_Publishing_House, 342 pages. Barcode 2020010004228   Scan available.

59. A Triennial Catalogue of Manuscripts 1916 -17 to 1918 - 1919 Vol III - Part I Sanskrit B  S. Kuppuswamy Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1922, Government Oriental Manuscripts Library Madras, 584 pages. Barcode 2020050088359   Scan available.

60. A Triennial Catalogue Of Manuscripts Vol 1 Part 1 Sanskrit ,a  M Rangacharya Rao; LANGUAGE. LINGUISTICS. LITERATURE, 1913, The Superintendent Government Press ,Madras, 526 pages. Barcode 5010010078066   Scan available.

61. A Triennial Catalogue Of Manuscripts Vol 1 Part 1 Sanskrit ,b  M Rangacharya Rao; LANGUAGE. LINGUISTICS. LITERATURE, 1913, The Superintendent Government Press ,Madras, 336 pages. Barcode 5010010078002   Scan available.

62. A Triennial Catalogue Of Manuscripts Vol 1 Part 1 Sanskrit ,c  M Rangacharya Rao; LANGUAGE. LINGUISTICS. LITERATURE, 1913, The Superintendent Government Press ,Madras, 358 pages. Barcode 5010010078163   Scan available.

63. A Triennial Catalogue Of Manuscripts Vol Ii Part I Sanskrit  S.kuppuswami Sastri; Literature, 1917, Government Press,Madras, 721 pages. Barcode 5010010004609   Server error, availability unknown.

64. A Triennial Catalogue Of Manuscripts1910 11 To 1912 13for The Government Oriental Manuscripts Library Madras Vol Iv, Part I, Sanskrit B Part 3 , Telugu  M Rangachary And S Kuppuswami Sastri; GEOGRAPHY. BIOGRAPHY. HISTORY, 1918, The Superintendent , Government Press , Madras, 497 pages. Barcode 5010010078010   Scan available.

65. A Vedic Word Concordance Vol 5 Part 2  Visva Bhandu; Religion, 1965, the v v r insitute, 174 pages. Barcode 2020010004266   Scan available.

66. A Vedic Word Concordance Vol Ii Part Ii  Visva Bandhu Sastry; Religion, 1936, Sarvoday_Sahitya_Mandir, 746 pages. Barcode 2020010004267   Scan available.

67. aabhaarapradashainamu  Jaggu Venkatachari; Art, 1943, Karonation Mudranalaya,Mysore, 346 pages. Barcode 5010010004348   Server error, availability unknown.

68. Aachaara Bhuushhand-ama~ Grantha 57  Paahatryambaka Oko; Religion. Theology, 1908, Aanandaashramamudrand-aalaye, 449 pages. Barcode 2030020016112   Scan not available.

69. aachaaraadar^sha (Manuscript)  Not Available; SOCIAL SCIENCES, 1826, Sri Venkateswara, 120 pages. Barcode 5010010033844   Server error, availability unknown.

70. Aachaaramayuukha Dvitiiya  miimaan'sakashriiniilakan't'habhat't'a; Language. Linguistics. Literature, 1915, gujaraatii mudrand-aalaya, mun'bayyaa, 142 pages. Barcode 5010010024291   Scan not available.

71. Aachaara~yaa Abhyudayaa  D'indi'ma Raajanaatha~; Language. Linguistics. Literature, 1945, Da Vasan'taa Presa~, 130 pages. Barcode 2030020016399   Scan not available.

72. Aachaarendu  Sri Pahvadatthareya Sastri; Social Sciences, 1909, Hari Narayana Apte, 408 pages. Barcode 5010010033954   Scan not available.

73. Aachaarendu Grantha 58  Aapat'e Hari Naaraayand-a; Religion. Theology, 1909, Aanandaashramamudrand-aalaye, 415 pages. Barcode 2030020016161   Scan not available.

74. Aadaitabrahmasid'i  gurucharana; LANGUAGE. LINGUISTICS. LITERATURE, 1932, University Of Calcutta , Calcutta, 319 pages. Barcode 5010010042518   Scan not available.

75. Aadhaanapadhdati  Aapat'e Mahaadeva Chimand-aajii; Religion. Theology, 1947, Aanandaa shramamudrand-aalaye, 145 pages. Barcode 2030020016073   Scan not available.

76. Aadipuraanama  Unknown; Religion. Theology, 999, Unknown, 1089 pages. Barcode 5010010010841   Scan not available.

77. Aadunika San'skrxta Naat'aka Nae Tathya Nayaa Itihaasa Bhaaga 1  raamajii upaadhyaaya; Language. Linguistics. Literature, 0, san'skrxta parishhada, saagara, 576 pages. Barcode 5010010024296   Scan not available.

78. Aagaashe Ispupaahai Gran'tha 5  Aapat'e Hari Naaraayand-a; Philosophy. Psychology, 1912, Aanandaashramamudrand-aalaaye, 103 pages. Barcode 2030020016011   Scan not available.

79. aagamapraamaand-yam  shrii raama mishra shaastri; Literature, 1876, Medicalhall-Nam Press , Benares, 210 pages. Barcode 5010010092177   Scan available.

80. Aagamapraamaand-yamu  yamunaachaarya svaami; Language. Linguistics. Literature, 1937, Sri Rameshvar Patakentana Yanthralaye Mudritamu, Vanasyamu, 100 pages. Barcode 5010010025631   Scan not available.

81. Aagamarahasyamu Vaatulashuddhaaravyamu  Not available; Language. Linguistics. Literature, 0, endowments commissioners office, bangalore, 105 pages. Barcode 5010010024297   Scan not available.

82. Aagamashaastramu Gaud'apaadiiyamu  bhat't'aachaaryend-a vidhushekharend-a; Language. Linguistics. Literature, 0, kalakattaa vishvavidhyaalaya, 352 pages. Barcode 5010010024298   Scan not available.

83. Aagniveshyagrxhyasuutramn  L.a. Ravi Varma; Language. Linguistics. Literature, 1940, University Of Travancore, Trivandrum, 220 pages. Barcode 5010010029769   Scan not available.

84. Aahnikapaddhati  Pandit Navya Chandidasa; Social Sciences, 1929, Sri Harisinghji Bahadur, 98 pages. Barcode 5010010030645   Scan not available.

85. aahvikachandrikaa  tukaaraama jaavaajii; Literature, 1911, Nirnayasagar Press , Mumbai, 210 pages. Barcode 5010010092006   Scan available.

86. Aanan'dalahari No.2  appayyadiikshita; Language. Linguistics. Literature, 1908, Sri Vani Vilas Press, Srirangam, 172 pages. Barcode 5010010024315   Scan not available.

87. aanandaashramasan'skuutagranthaavali'  krisnaswami saashtri; Religion, 1890, Nirnaya Sagar Press, Bombay, 225 pages. Barcode 5010010087176   Scan not available.

88. aanandaashramasan'skuutayenthaavali'  mahaadeva chimand-aajii aapat'e; Religion, 1921, I.S. Natesa Sastri and Co., Mayavaram, 498 pages. Barcode 5010010087241   Scan not available.

89. Aanandaashramasn'skrxtagranthaavali Gran'nthaang-ka 70  shriidharaachaarya; Language. Linguistics. Literature, 1912, aanandraasharamamudrand-aalayamu, 172 pages. Barcode 5010010017730   Scan not available.

90. Aanandakandachampuu  Mishraa Mitra; Social Sciences, 1931, Vidya Vilaasa Presa~, 260 pages. Barcode 2030020016315   Scan not available.

91. aanandamaalaa  Bannanje Govindacharya; Bhagavadgita, 1970, Dasapramati Prakasana Samiti Udipi, 183 pages. Barcode 5010010004467   Server error, availability unknown.

92. Aanandamathaadhikarand-amaaramya Pradhaman' Paadan  Unknown; Unknown, 999, Unknown, 177 pages. Barcode 5010010010757   Scan not available.

93. aanandananandinii  Dr.mlampalli Chandra Sekhar Sarma; Religion, 1970, Financial assistance of TTD, 233 pages. Barcode 5010010006545   Scan not available.

94. Aang-agatvanirukti Naama Prabandha Etatpustakan  shriimanmuraarimishra; Language. Linguistics. Literature, 1973, aanandaashramamudrand-aalaya, 90 pages. Barcode 5010010024318   Scan not available.

95. Aangiirasasmrxtii  a n krishna aiyangar; Language. Linguistics. Literature, 1953, adyar library, 228 pages. Barcode 5010010017355   Scan not available.

96. Aapastambadharmasuutramanj-jarii  r. n. suryanarayana; Language. Linguistics. Literature, 1933, adhyathma prakasha press, bangalore, 130 pages. Barcode 5010010024319   Scan not available.

97. Aapastambadharmasuutramanj-jarii  r. n. suryanarayana; Language. Linguistics. Literature, 1933, adhyathma prakasha press, bangalore, 130 pages. Barcode 5010010025639   Scan not available.

98. Aapastambadharmasuutramu  e. mahaadevashaastri; Language. Linguistics. Literature, 1898, the government branch press, 472 pages. Barcode 5010010017960   Scan not available.

99. Aapastambaparibhaashaasuutramuu  kapardisvaami; Language. Linguistics. Literature, 1893, maisuuru mahaaraaja, 122 pages. Barcode 5010010017961   Scan not available.

100. Aapastambashulbasutrama~  Aapastan'ba; Philosophy. Psychology, 1931, Gavara~nament'a~ Braan'cha~Pressa~ Maisura~, 352 pages. Barcode 2030020016226   Scan not available.

101. Aapastambashulbasuutramu  d srinivaasaacharya; Language. Linguistics. Literature, 1931, the government branch press mysore, 513 pages. Barcode 5010010017350   Scan not available.

102. Aapastambasulbasuutran' Kapaaradibhaashhyend-a Karavindi Sundararajavyaakhyaabhyan' Cha Sahitan  D. Srinivasachar; Language. Linguistics. Literature, 1931, Oriental Library, University Of Mysore, 340 pages. Barcode 5010010029082   Scan not available.

103. Aapastambhagrihyasuutra Anakula Tatparyadarshana  haradatta mishra; Language. Linguistics. Literature, 1928, chaukhamba sanskrit series office, benares, 340 pages. Barcode 5010010024320   Scan not available.

104. Aapastambiiya Dharmasuutramu  not availabe; Language. Linguistics. Literature, 0, Not Available, 307 pages. Barcode 5010010024338   Scan not available.

105. Aapastambiiya Dharmasuutramu  not availabe; Language. Linguistics. Literature, 0, Not Available, 314 pages. Barcode 5010010024321   Scan not available.

106. Aapastambiiyam' Shraotasuutram  Narasimhachar; Language. Linguistics. Literature, 1944, Oriental Library Publications, 814 pages. Barcode 5010010029753   Scan not available.

107. Aapastambiiyan' Shraotasuutrama~  Chaara~ya Narasin'haa; Religion. Theology, 1944, Oriend-t'ala Laibrarii Pablikeshansa, 816 pages. Barcode 2030020016173   Scan not available.

108. Aapracharya Yasak Ki Vedvyakhya Paddhati  Dr Gyan Prakash Shastry; Unknown, 1985, SREE PUBLICATION HOUSE, 164 pages. Barcode 2020010003705   Scan available.

109. Aapradarshprastavmala Vol I  Pandit Sri Vishwanath Shastry; Unknown, 1951, MOTILAL BANARSIDAS, 147 pages. Barcode 2020010003706   Scan available.

110. Aaprayyorday Kavyam Poorvadharm  Pandit Ganga Prasad Upadhyay; Unknown, 999, KALA PRESS, 250 pages. Barcode 2020010003707   Scan available.

111. Aapstamba Shulba Suutrama~  Chaara Shriinivaasa; Religion. Theology, 1931, Maisuura Mahaaraajaa, 352 pages. Barcode 2030020016136   Scan not available.

112. Aara~tha Shaastra Padasuuchii Trxtiiyo Bhaaga  Shaastri Shamaa; Social Sciences, 1925, Oriend-t'ala Laibrarii, 358 pages. Barcode 2030020016170   Scan not available.

113. Aara~thavara~nd-a Jyotishhama~  Dattaa Bhagavata; Religion. Theology, 1924, Motilal Banarsi Das, 45 pages. Barcode 2030020016009   Scan not available.

114. Aara~yaasaptashatii Faskikyulasa~1,2 Cha  Shriivishveshvaraapand-d'ita; Religion. Theology, 1925, Vidhyaa Vilasa~ Presa~, 376 pages. Barcode 2030020016157   Scan not available.

115. aarogyachintaamand-ii  S.viswanatha Sarma; Science, 1951, Government Oriental Manuscripts Library Madras, 318 pages. Barcode 5010010004543   Server error, availability unknown.

116. aaryabhadt'iiyam'of Aryabhattacarya Part 1 gaanitapaada  Sri Ganapathi Sastri; Natural Sciences, 1930, The Maharani Regent Of Travancore, 216 pages. Barcode 5010010026514   Scan not available.

117. aaryacharitram  vi. krxshhnd-aswaamyaaryend-a; Literature, 1908, Sri Vanivilas Press, 760 pages. Barcode 5010010091996   Scan available.

118. aaryaividhaasudhaakaran  Yasneswara cimana Bhatta; Science, 1940, Motilal Banarsidass, Lahore, 236 pages. Barcode 5010010006651   Scan not available.

119. aaryemanju qs-imulakalpa ddhitiiya bhaaga  T. Ganapathi Sastri; Religion. Theology, 1922, Trivendrum Sanskrit Series Publications, 308 pages. Barcode 5010010026500   Scan not available.

120. aaryemanju qs-imulakalpa prathamoo bhaaga  Sri Ganapathi Sastri; Religion. Theology, 1920, Sri Ganapathi Sastri, 270 pages. Barcode 5010010026513   Scan not available.

121. aaryemanju qs-imulakalpa tuutiyo bhaaga  T. Ganapathi Sastri; Philosophy. Psychology, 1924, T. Ganapathi Sastri, 196 pages. Barcode 5010010026512   Scan not available.

122. aasechanakaraamaayand-ama~  Sri Subrahmanya Suri; LANGUAGE. LINGUISTICS. LITERATURE, 1932, S. Sankaranarayanan, 64 pages. Barcode 5010010033719   Server error, availability unknown.

123. Aasechanakaraamaayand-amu  Brahmasri Subrahmanya Suri; Language. Linguistics. Literature, 1932, S. Sankaranarayanan , Chennai ., 76 pages. Barcode 5010010012339   Scan not available.

124. aashauchaashht'akan'  tan'. gand-apatishaastrind-aa; Literature, 1915, Rajakeeya Press, 48 pages. Barcode 5010010092058   Scan available.

125. aashauchachintaamand-i  V. Venkata Ramasharma Vidya Bushan; SOCIAL SCIENCES, 1922, P. Govinda Sharma, 287 pages. Barcode 5010010030678   Server error, availability unknown.

126. Aashvalaayana Shraota Suutrama~ Prathamo Bhaaga  Shaastri Man'gala Deva; Religion. Theology, 1938, Not Available, 187 pages. Barcode 2030020016176   Scan not available.

127. Aashvalaayanagrxhyasuutran  Sri Bhavani Shankara Sharma; Language. Linguistics. Literature, 1909, Pandit Jestaram Mukund, 370 pages. Barcode 5010010029062   Scan not available.

128. Aashvalaayanagrxhyasuutran' Shriiharadattamishravirachita Anaavilaakhyayaa Vrxttyaa Sametn  T. Ganapathi Sastri; Language. Linguistics. Literature, 1923, Maharaja Of Travancore, 278 pages. Barcode 5010010029085   Scan not available.

129. aashvalaayanasuutraprayogadiipikaa  shriisomanaathopaadhyaayen; Literature, 1907, Vidyavilas Chapkhana, 204 pages. Barcode 5010010091916   Scan available.

130. aashvalaayaniiyaguhaasutraand-aa suchiipatramu  Bhattacharya; , 1970, BHATTACHARYA,BARODA, 373 pages. Barcode 5010010006929   Scan not available.

131. Aatakam  Pandith Sri Seetharam Bhakruth; Unknown, 999, THAKUR PRASAD AND SONS, 402 pages. Barcode 2020010004572   Scan available.

132. Aath Shri Madrunu Bhasyam  Shri Vallabha Charya; Unknown, 999, -, 792 pages. Barcode 2020010003714   Scan available.

133. Aath Shrimadbhagwatha Darshini Ekhadarshaskarandra Prarbhaythe  -; Unknown, 999, -, 478 pages. Barcode 2020010003713   Scan available.

134. Aath Smrithisaarodhwarprarambh  -; Unknown, 999, Navahindh_Publications, 102 pages. Barcode 2020010003715   Scan available.

135. Aath Vamanpuranam Prarabhyathe  -; Unknown, 999, Sri_Venkateshwar_Steem_Press, 420 pages. Barcode 2020010003716   Scan available.

136. Aatha Sankhya Darshana Bhashanuvaada  -; Language. Linguistics. Literature, 0, -, 742 pages. Barcode 2020050036075   Scan not available.

137. Aatma Kathaa Prathama Khand-d'a  mahaatmaa gaan'dhii; General, 0, sastaa man'd'ala, 421 pages. Barcode 5010010012509   Scan not available.

138. Aatmadarshanam  Vedhanth Anjaneyakumara Swamy; Unknown, 1987, khandriya Vidyalaya, 178 pages. Barcode 2020010003717   Scan available.

139. Aatmatattva Vivekaa  Sri Udayana; Philosophy. Psychology, 999, Not Available, 216 pages. Barcode 5010010033920   Scan not available.

140. Aatmatattvaviveka  virachitayaa; LANGUAGE. LINGUISTICS. LITERATURE, 1925, Chowkhamba Sanskrit Series , Benares, 498 pages. Barcode 5010010042568   Scan not available.

141. Aatmoduugaara  Not available; Language. Linguistics. Literature, 0, Not available, 268 pages. Barcode 5010010024328   Scan not available.

142. Aatyoug Pradipika  Shemraj Shri Krishnadass; Unknown, 1874, Shri Venkatadra Steam Muddhyatralaya, 236 pages. Barcode 2020010003719   Scan available.

143. Aavimaarakan'  ta . gand-apatishaastrind-aa; LANGUAGE. LINGUISTICS. LITERATURE, 1912, The Travancore Government Press , Trivandrum, 130 pages. Barcode 5010010077737   Scan available.

144. Aavyamimaan'saa  Rajasekhara; Language. Linguistics. Literature, 1934, Oriental Institute , Baroda ., 385 pages. Barcode 5010010012547   Scan not available.

145. Aayaisaptashati  shriigovadhainaachayai; General, 1895, Tukaram Javaji,Bombay, 238 pages. Barcode 5010010032899   Scan not available.

146. Aayura~vedasutrama~  Yogaanandanaatha; Philosophy. Psychology, 1922, Da Gavara~nament'a Brancha~ Presa~, 356 pages. Barcode 2030020016424   Scan not available.

147. aayurvedavijnj-aanam  Not available; Literature, 1895, Not available, 708 pages. Barcode 5010010092119   Scan available.

148. Aayurveidamahoodadhau Annapaanavidhi  ven'kat'a subramand-ya shaastri; Technology, 1950, Sri Venkateshwara Printing Works, Kumbakonam, 142 pages. Barcode 5010010028155   Scan not available.

149. Abhaavavimarsha  diipikaa ghosha; Language. Linguistics. Literature, 1984, sampurnaanand sanskrit vishvavidyalaya, varanasi, 136 pages. Barcode 5010010024331   Scan not available.

150. Abhidavimarsh  Yogeshwar Dutt Sharma; Unknown, 1980, EASTERN BOOK LINKERS, 150 pages. Barcode 2020010003726   Scan available.

151. Abhidhaana Ratnamaalaa  Aupharet'a; Language. Linguistics. Literature, 1928, Motilaala Banaarasi Daasa, 419 pages. Barcode 2030020016099   Scan not available.

152. Abhidhaavrittimaatrika Shabdavyaapaara Vichaara  mukula bhatta; Language. Linguistics. Literature, 1916, nirnayasagar press, bombay, 42 pages. Barcode 5010010024332   Scan not available.

153. Abhidhana Manjari Of Bhishagarya  Shankar Sharmana; Unknown, 999, Vidysarathy_Press, 530 pages. Barcode 2020010003727   Scan available.

154. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I  Vijayarajendra Suri; Unknown, 1910, B_R_Publishing_Corp, 1056 pages. Barcode 2020010003733   Scan available.

155. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I I I  Vijayarajendra Suri; Unknown, 1910, B_R_Publishing_Corp, 1378 pages. Barcode 2020010003732   Scan available.

156. Abhidhanarajendrah Prakrit Magadhi Sanskrith Vol I V  Vijayarajendra Suri; Unknown, 1910, B_R_Publishing_Corp, 1297 pages. Barcode 2020010003731   Scan available.

157. Abhidhanarajendrah Prakrit Magadhi Sanskrithvol I I  Vijayarajendra Suri; Unknown, 1910, B_R_Publishing_Corp, 728 pages. Barcode 2020010003730   Scan available.

158. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 6  Vijayarajendra Suri; Unknown, 1985, B_R_Publishing_Corp, 1482 pages. Barcode 2020010003728   Scan available.

159. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 7  Vijayarajendra Suri; Unknown, 1985, B_R_Publishing_Corp, 1217 pages. Barcode 2020010003729   Scan not available.

160. Abhidhanarajendrah Vol.4  Vijayarajendra Suri; Unknown, 1910, B_R_Publishing_Corp, 1301 pages. Barcode 2020010003734   Scan available.

161. Abhidhanarajendrah Vol.5  Vijayarajenda Suri; Unknown, 1910, B.R.publishing Crop., 1618 pages. Barcode 2020010003735   Scan available.

162. Abhidhanaratnamala  Th Aufrecht; Unknown, 1861, Williams_And_Norgate, 405 pages. Barcode 2020010003736   Scan available.

163. Abhidhara~maamrxtama~  Ghoshhaka; Religion. Theology, 1953, Vishvabhaaratii Shan'tiniketana~, 172 pages. Barcode 2030020016265   Scan not available.

164. Abhidhara~maasamuchchayasya  Asan'gaa; Religion. Theology, 1950, Vishva Bhaarati Shan'tiniketana~, 161 pages. Barcode 2030020016268   Scan not available.

165. Abhidhara~masamuchchaya  Aasn'ga; Religion. Theology, 1950, Prabhataa Kumaara Mukara~jii, 152 pages. Barcode 2030020016307   Scan not available.

166. Abhidharmakocarikah  Vasubandhu; Unknown, 1992, Motilal Banarsidass Publishers, 208 pages. Barcode 2020010003737   Scan available.

167. Abhidharmamrta Of Ghosaka  Shanti Bhikshu Sastri; Unknown, 1953, Visvabharathi Santiniketan, 170 pages. Barcode 2020010003738   Scan available.

168. Abhijaanshaakuntlamuu  raajaraajavarmnd-aa; LANGUAGE. LINGUISTICS. LITERATURE, 1913, H H The Maharaja's College Trivandrum, 200 pages. Barcode 5010010078710   Scan available.

169. Abhijnaashaakuntala  shrii kaasinaatha dviveidi; Religion. Theology, 1969, The chowkamba Vidyabhavan, Varanasi, 336 pages. Barcode 5010010028156   Scan not available.

170. Abhijnana Sakuntala  Ganesh Kashinath Kale; Unknown, 1973, LAXMIVENKATESHWAR MUDRANALAY, 464 pages. Barcode 2020010003742   Scan available.

171. Abhijnana Sakuntalam  Sri Chelamcheral Rangacharya; Unknown, 1982, ANDHRA PRADESH SAHITYA ACADEMY, 210 pages. Barcode 2020010003741   Scan available.

172. Abhijnana Sakuntalam  Mahakavi Kalidasa; Unknown, 1991, Krishnadas_Academy, 879 pages. Barcode 2020010010072   Server error, availability unknown.

173. Abhijnana Sakuntalam Naam Natakam  Sri Guru Prasad Shastry; Unknown, 999, BHARGAV PUSTAKALAY, 648 pages. Barcode 2020010003739   Scan available.

174. Abhijnana Sakuntalam Of Kalidasa  Satavadhana Srinivascharya; Unknown, 1950, V RAMASWAMY SASTRULU AND SONS, 690 pages. Barcode 2020010003740   Scan available.

175. Abhijnana Sakuntalam Of Kalidasa  Mr.kale; Unknown, 1990, MOTILAL BANARSI DASS, 620 pages. Barcode 2020010010071   Server error, availability unknown.

176. Abhijnana Sakuntalam Of Kalidasa  ramanath jha; Language. Linguistics. Literature, 1957, Mithila Institute Of Post - Graduate Studies and Research In Sanskrit Learning , Darbhanga, 428 pages. Barcode 5010010012324   Scan not available.

177. abhijnana sakuntaluma  kalidaasa; Religion, 1871, Jnanarathnakara Press, Calcutta, 332 pages. Barcode 5010010087204   Scan not available.

178. abhijnanashaakuntalamu  shriikaalidaasa; LANGUAGE. LINGUISTICS. LITERATURE, 1891, The Navyasagar press, Bombay, 392 pages. Barcode 5010010032856   Server error, availability unknown.

179. Abhilaashhitaarthachintaamand-i Prathamabhaaga Aadita Trxtiiyaprakarand-antamu  someshvaradeva; Religion. Theology, 1926, government branch press, mysore, 440 pages. Barcode 5010010025640   Scan not available.

180. abhilashhitaartaaryaichintaamand-in  R. Sharma Sastri; Religion, 1926, The _GOvernment_ Branch _Press_Mysore, 438 pages. Barcode 5010010000176   Server error, availability unknown.

181. Abhilashhitaayrachintaamand-i  soomeishvara deva; Language. Linguistics. Literature, 1926, The Government Branch Press , Mysore ., 440 pages. Barcode 5010010012326   Scan not available.

182. Abhilekha Sangraha Sixth Khandah  Bahadur Chand Chhabra; Unknown, 1964, Sahitya_Academy, 130 pages. Barcode 2020010003743   Scan available.

183. Abhilekhamaalaa Vishvavidhyaalayapariqs-aanirdhaarita Abhilekhasan'graha Raama Hindiivyaakhyopetaa  pan' ramaakaanta jhaa; Language. Linguistics. Literature, 1972, chaukhambaa vidhyaabhavana vaaraand-asii, 174 pages. Barcode 5010010025641   Scan not available.

184. Abhinana Shakuntalam  kalidasa; Language. Linguistics. Literature, 0, pandurang jawaji bombay, 276 pages. Barcode 2020050036375   Scan not available.

185. abhinava chandrikaayaamu  Satya Nidhi Theertha; Literature, 1926, The _GOvernment_ Branch _Press_Mysore, 561 pages. Barcode 5010010000177   Server error, availability unknown.

186. Abhinava San'skrta Pravesha  ma shri deshapaan'd'e; LANGUAGE. LINGUISTICS. LITERATURE, 1942, k.t.shahni, 296 pages. Barcode 5010010034310   Scan not available.

187. Abhinava Vaasavadatta  Narakand-t'hirava Shaastri Vat't'ipalli; Language. Linguistics. Literature, 1912, San'skrxta Parishhata~, 40 pages. Barcode 2030020016199   Scan not available.

188. Abhinava Vikrutivignaana  vaidha yaadavaji trikamaji aachaaryai; Technology, 999, Chowkamba samskruth pustakalayamu, Banras, 100 pages. Barcode 5010010032597   Scan not available.

189. Abhinavakaustubhamaalaa Daqs-ind-aamuurttistavoo  t ganapati sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1905, the travanacore government press, trivandrum, 20 pages. Barcode 5010010078278   Scan available.

190. Abhinavam Prasutitantram First Edition  Pandith Damodar Sharma Gaud; Unknown, 1950, Pandith_Shyamsundar_Sharma_Swami_Laxmiram_Trust, 100 pages. Barcode 2020010003747   Scan available.

191. Abhinavaratnamaala Davitiiya Bhaaga  Paand-d'uran'ga Oke Mahadevo; Technology, 1922, Vijayaa Presa~, 194 pages. Barcode 2030020016224   Scan not available.

192. abhiraajasahastrakamu  Triveni Kavi; Literature, 2000, Vaijayanta Prakashana, Allahabad, 131 pages. Barcode 5010010000179   Server error, availability unknown.

193. Abhisamayalankara Prajnaparamita Upadesa Sastra  E.obermiller; Unknown, 1992, Motilal Banarasidass Publishers, 134 pages. Barcode 2020010003749   Scan available.

194. abhishhekanaat'akan'  tan'. gand-apatishaastrind-aa; Literature, 1913, Rajakeeya Press, 92 pages. Barcode 5010010091976   Scan available.

195. Achala Meraa Koii  vendaachanalaala; LANGUAGE. LINGUISTICS. LITERATURE, 1948, Mathura Prakashan , Basra, 288 pages. Barcode 5010010042328   Scan not available.

196. Acharya Ddhruva Smaraka Grantha Vol 3  Rasiklal C. Parikh; Unknown, 1946, Gujarat_Vidya_Sabha, 284 pages. Barcode 2020010003764   Scan available.

197. Acharya Jinabhadras Visesavasyakabhasya Part Iii  Dalshuk Malvania; Unknown, 1968, Lal Bhai Dalpatbhai Bharatiya Sanskriti Vidyamandira, 364 pages. Barcode 2020010003765   Scan not available.

198. Achyutaraayaabhyudayamuu Sriiraajanaathamahaakavikuutamuu  pandit r v krishnamachariar; LANGUAGE. LINGUISTICS. LITERATURE, 1907, Sri Vani Vilas Press , Srirangam, 168 pages. Barcode 5010010078728   Scan available.

199. Achyutaraayaabhyudayamuu Sriiraajanaathamahaakavikuutamuu Part I  pandit r v krishnamachariar; LANGUAGE. LINGUISTICS. LITERATURE, 1907, Sri Vani Vilas Press , Srirangam, 168 pages. Barcode 5010010079899   Scan not available.

200. Acyutarayabhyudaya Of Rajanatha Dindima  A N Krishna Aiyangar; Unknown, 1945, ADYAR LIBRARY, 120 pages. Barcode 2020010003772   Scan available.

201. ad'agatvanirukitan  Murari Mishra; Unknown, 1973, Anandashrama,Pune, 92 pages. Barcode 5010010000310   Server error, availability unknown.

202. adaitasidi'  hariharashaastrind-aa; Religion, 1893, , 353 pages. Barcode 5010010087177   Scan not available.

203. Adbud Vijay  pandit shri bellakonda ramaraya kavindra; Language. Linguistics. Literature, 1944, -, 72 pages. Barcode 2020050036372   Scan not available.

204. Addaitasiddhi Dditiiyan' San'skarand-an  Sarasvatii Madhusudhana; Philosophy. Psychology, 1937, Paan'd'uran'ga Javaaji, 993 pages. Barcode 2030020016183   Scan not available.

205. addvataamakaranda  Lakshmidhar; Philosophy. Psychology, 1926, Sri Vani Vilas Press, 62 pages. Barcode 5010010026510   Scan not available.

206. addvatamaatend-d'a  Sri Ananta Krishna Sastri; Philosophy. Psychology, 1630, Kishorilala Kadiya, Calcutta, 158 pages. Barcode 5010010026509   Scan not available.

207. addvatatarand-i  Sri Natesh; Philosophy. Psychology, 1926, Mr. Janaki ram,Mylaore, 154 pages. Barcode 5010010026508   Scan not available.

208. Adharsha Prasthav Rathnamala  Sri Viswanatha Shastri Prabhakar; Unknown, 999, Mothilal_Banarassi_Dass, 326 pages. Barcode 2020010003783   Scan available.

209. Adharva Vedha Samhitha  Pandit Ramachandra Sharman; Unknown, 999, Sanathan_Darma_Yanthralayam, 732 pages. Barcode 2020010003784   Scan available.

210. Adhikaara Kaa Prashna  bhagavatiprasaada vaajapeiyi; Language. Linguistics. Literature, 1973, esa chanda end-d'a kampani limit'ed'a, 161 pages. Barcode 5010010012328   Scan not available.

211. Adhikaarand-a Saaraaval'i  srimad vedaanta desikulu; Language. Linguistics. Literature, 1974, sri nilayam madras, 829 pages. Barcode 5010010018020   Scan not available.

212. adhikarand-asaaraalalin  Kumaravedantacharya; Literature, 1875, Lakshminarasimhacharya, 242 pages. Barcode 5010010004353   Server error, availability unknown.

213. Adhikarand-asaaraavali  shriivand-shat'hakopashriilaqs-miinrxsin'vashat'hakopayatiindramahaadeshikaa; Language. Linguistics. Literature, 0, Not available, 891 pages. Barcode 5010010018021   Scan not available.

214. adhikarand-asaraavali  Chintamani; Philosophy. Psychology, 1940, Lakshmi Narasimha acharya, 882 pages. Barcode 5010010026507   Scan not available.

215. Adhvaramiimaan'saa Kutuuhalavrxtti  d'aa bii gopaalared'd'ii; Language. Linguistics. Literature, 1969, vaaraand-aseyasan'skrxtavishvavidhyaalaya, 660 pages. Barcode 5010010025829   Scan not available.

216. Adhyaatmakalpadruma Adhirohand-iit'ippand-isahita  shriimunisundarasuuri; Religion. Theology, 0, Not available, 78 pages. Barcode 5010010024349   Scan not available.

217. Adhyaatmapat'alamam  Sri Ganapathy Sastri; Social Sciences, 1915, Sri Mulakara Sarma, 44 pages. Barcode 5010010030676   Scan not available.

218. Adhyaatmaraamaayand-amu  Not available; Language. Linguistics. Literature, 0, Not available, 302 pages. Barcode 5010010012330   Scan not available.

219. Adhyathyamramayana Vol Iii  Srimath Paramhans Parivrajakachary; Unknown, 1947, Navahind_Publications, 522 pages. Barcode 2020010003792   Scan available.

220. Advaita Siddi Vol. I  d'i. shriinivaasaachaari; Language. Linguistics. Literature, 1933, Government Branch Press,Mysore, 524 pages. Barcode 5010010025079   Scan not available.

221. Advaitaamoda  vaasudevashaastrii; Language. Linguistics. Literature, 1928, aanandaashramamudrand-aalaya, 195 pages. Barcode 5010010024351   Scan not available.

222. Advaitaanyamatakhand-d'anamu  Not available; Language. Linguistics. Literature, 0, Not available, 77 pages. Barcode 5010010025830   Scan not available.

223. Advaitaaqs-aramaalikaa  advaitasabhaasuvarnd-amahotsave; Religion. Theology, 1946, shriikaamakot'i koshasthaana kumbhaghond-amu, 491 pages. Barcode 5010010024352   Scan not available.

224. Advaitadiipikaa Dvitiiyobhaaga  Not available; Language. Linguistics. Literature, 0, Not available, 120 pages. Barcode 5010010024353   Scan not available.

225. advaitadiipikaa vaataagama'  ; Religion, 1921, Sviyayantralayam Press, Bangalore, 222 pages. Barcode 5010010087218   Scan not available.

226. advaitamaartaand-d'a  shriimadanantakrxshhnd-a shaastri; Literature, 1630, Vinak Press , Kolkatta, 158 pages. Barcode 5010010091961   Scan available.

227. Advaitamanj-jarii Brahmavidhyaabharand-amu  Not available; Language. Linguistics. Literature, 0, Not available, 842 pages. Barcode 5010010025831   Scan not available.

228. advaitamat'urii  ; Religion, 1921, , 212 pages. Barcode 5010010087247   Scan not available.

229. advaitasiddhi  hariharashaastriind-aa; Literature, 1893, Sri Vidya Press , Kumbhakonam, 348 pages. Barcode 5010010092168   Scan available.

230. Advaitasiddhi  shiromand-ishriimadhusuudanasarasvatii; Language. Linguistics. Literature, 1893, shriividhyaamudraaqs-arashaala, 386 pages. Barcode 5010010025832   Scan not available.

231. Advaitasiddhi Guruchanddrikaasavyakhyaayasamalang-krxtaa Dvitiiyasamput'amu  vidvan s narayanaswami shastri; Language. Linguistics. Literature, 1937, government branch press, mysore, 445 pages. Barcode 5010010024354   Scan not available.

232. Advaitasiddhi Mithyatvamithyaatvaanto Bhaaga  shriimatparamahan'samadhusuudanasarasvatii; Language. Linguistics. Literature, 1915, nirnayasagar press, bombay, 250 pages. Barcode 5010010025833   Scan not available.

233. Advaitasiddhi Prathamasamput'ama~  Sarasvatii Madhusudhana; Philosophy. Psychology, 1933, Da Gavara~namen't'a~ Brancha~ Presa~, 532 pages. Barcode 2030020015988   Scan not available.

234. Advaitasiddhi Trxtiiyaasamput'amu  guruchandriikaa; Religion. Theology, 1939, government branch press mysore, 252 pages. Barcode 5010010018022   Scan not available.

235. Advaitasiddhi Trxtiiyasamput'ama~  Sarasvatii Madhusudhanaa; Philosophy. Psychology, 1940, Da Gavara~namen't'a~ Brancha~ Presa~, 260 pages. Barcode 2030020016335   Scan not available.

236. advaitasiddhisiddhaantasaara  shriigad'gaadhara shaastriind-aa; Literature, 1857, Not available, 499 pages. Barcode 5010010092141   Scan available.

237. Advaithdeepika  Srimannarayana; Unknown, 999, E.j.lajram_ _Co, 882 pages. Barcode 2020010003810   Scan available.

238. Advaitibhraan'tiprakaasha  Not available; Language. Linguistics. Literature, 0, Not available, 92 pages. Barcode 5010010025834   Scan not available.

239. Advaitibhraan'tiprakaasha  Not available; Language. Linguistics. Literature, 0, Not available, 92 pages. Barcode 5010010028316   Scan not available.

240. advatacsiddddhaantagurucchandrikaa  sri Paramahamsa perivrajaka Chandrikacharya; Philosophy. Psychology, 0, v. Annadanam, Tiruchi, 396 pages. Barcode 5010010026506   Scan not available.

241. advatadipikaa  Pandit Anantha Krishna Sastri; Literature, 1997, Jagadesh Narayana Thivari Thura Vakrutha Press, 204 pages. Barcode 5010010004408   Server error, availability unknown.

242. advatadipikaa dhvitiyo bhaagan  Narayana Sharma; Religion, 1984, Director Research Centre Varanasi, 487 pages. Barcode 5010010000216   Server error, availability unknown.

243. advatadipikaa tutiiyo bhaagan  Narasimha Sarma; Literature, 1987, Harish ChandraMani Tripathi, Varanasi, 99 pages. Barcode 5010010000214   Server error, availability unknown.

244. advatamajjarii nyaayaraqs-aamand-in  Ganapathi Sastry; Art, 1905, Sri Vidya Mudraksharalaya, 373 pages. Barcode 5010010004409   Server error, availability unknown.

245. advatasiddhaantasaarasam'grah  Narayanasrama; Philosophy. Psychology, 1935, Panduranga Javachi, 118 pages. Barcode 5010010026504   Scan not available.

246. Advatatatvasudhaa Dvitiiya Bhaaga  Not available; Language. Linguistics. Literature, 1962, Not available, 617 pages. Barcode 5010010017962   Scan not available.

247. Advatatatvasudhaa Prathamoo Bhaaga  Not available; Language. Linguistics. Literature, 1960, Not available, 678 pages. Barcode 5010010017963   Scan not available.

248. Advatatatvasudhaa Prathamoo Bhaaga  Not available; Language. Linguistics. Literature, 1960, Not available, 362 pages. Barcode 5010010017352   Scan not available.

249. advayavajrasan'graha  Mahamahopadyaya Hariprasad Sastri; Religion. Theology, 1927, Oriental Institute, Baroda, 120 pages. Barcode 5010010026502   Scan not available.

250. agamakoshaa dvadasho bhaagan  S.k.ramachandra Rao; History, 1994, Kalpatharu Research Academy Bangalore, 402 pages. Barcode 5010010004414   Server error, availability unknown.

251. Agnihotra Chandrikaa Grantha 87  Shaastri Vaamana; Religion. Theology, 1921, Aanandaashramamudrand-aalaye, 304 pages. Barcode 2030020016185   Scan not available.

252. Agnihotrachandrikaa  vinaayaka gand-esha aapat'e; Language. Linguistics. Literature, 1921, aanandaashramamudrand-aalaya, 732 pages. Barcode 5010010025835   Scan not available.

253. Agnihotrachandrikaa Vaamana Shaastri Krxtaa  vaamana shaastri; Language. Linguistics. Literature, 1921, Vinayaka Ganesha Apte, Ananda Ashrama Publications, 312 pages. Barcode 5010010029045   Scan not available.

254. Agnipuraand-ama~ Grantha 41  Aapat'e Hari Naaraayand-a; Social Sciences, 1900, Aanandaa Shramamudrand-aalaye, 518 pages. Barcode 2030020016084   Scan not available.

255. agnipuraand-amu vedikaa  Maharshi Vedavyas; Religion, 1957, Clive_Row_Calcutta, 874 pages. Barcode 5010010004416   Server error, availability unknown.

256. agniveshyagruhaasutre  L.a.ravi Varma; History, 1940, The Baskara Press, Trivandrum, 226 pages. Barcode 5010010004417   Server error, availability unknown.

257. ahalyaacharitan'  ; Religion, 1921, , 178 pages. Barcode 5010010087181   Scan not available.

258. Aitareiya Brahmanama  Vishvanatha Balakrishna Sastri; Language. Linguistics. Literature, 1916, Government Centrel Book Depot, Bombay, 222 pages. Barcode 5010010024358   Scan not available.

259. Aitareya Brahmana Of Sadgurusisya Vol I 1 To 15 Adhyayas  R. Anantakrisna Sastri; Language. Linguistics. Literature, 1942, University of Travancore, 662 pages. Barcode 5010010029077   Scan not available.

260. Aitareyaalochanan  Acharya Satyavrata Samasrami; Language. Linguistics. Literature, 1906, The Asiatic Society Of bengal, 238 pages. Barcode 5010010029061   Scan not available.

261. Aitareyaarand-yakan  Baba Sastri Padake; Language. Linguistics. Literature, 1898, Hari Narayan Apte, Ananda Ashrama Publications, 306 pages. Barcode 5010010029044   Scan not available.

262. Aitareyabraahmand-a  Not available; Language. Linguistics. Literature, 0, Not available, 505 pages. Barcode 5010010024359   Scan not available.

263. Aitareyabraahmand-a  Not available; Language. Linguistics. Literature, 0, Not available, 302 pages. Barcode 5010010025836   Scan not available.

264. Aitareyabraahmand-amam  Sri Mathsayana Aacharya; Language. Linguistics. Literature, 999, Not Available, 540 pages. Barcode 5010010029910   Scan not available.

265. Aitareyopanishhata~ Panj-jamii Khand-d'a Grantha 11  Aanandagiri; Religion. Theology, 1931, Aanandaashramamudrand-aalaye, 139 pages. Barcode 2030020016188   Scan not available.

266. Ajit' Gaamaa Vol.ii  yan.aar. bhat't'a; Language. Linguistics. Literature, 1967, Institute Francais Dindologie, Pondichery, 230 pages. Barcode 5010010024361   Scan not available.

267. Ajnanadhavanta Candabhaskarah  Subrahmanya Sharma, C.v.s; Enter Subject Of The Book, 1996, Sivasyamala Granthamala, Tirupati, 282 pages. Barcode 2020010021783   Scan available.

268. akalanka grandhatrayamu  Jinvijaya Muni; Literature, 1937, THE VAYAVSTHAPAKA SINGHI JAIN GRANTHAMALA, CALCUTTA, 386 pages. Barcode 5010010004436   Server error, availability unknown.

269. Akaradhanukrmanika  Misropahvedacharyapandithsrivamshidharshastriyna; Unknown, 1997, Achyut Granthmala Karyalay, 138 pages. Barcode 2020010003860   Scan available.

270. Akasmika Dana Laba Ke Yoga  Sri Bharateeya Yogi; Religion. Theology, 999, Sanskrit Samastan Bariel, 100 pages. Barcode 2020050017231   Scan available.

271. alad'kaarasuutran'  ta. gand-apatishaastrind-aa; Literature, 1915, Rajakeeya Press, 285 pages. Barcode 5010010091984   Scan available.

272. Alamkaras In The Works Of Banabhatta  Dr Raj Kumari Trikha; Unknown, 1982, PARIMAL PUBLICATIONS, 46 pages. Barcode 2020010003867   Scan available.

273. Alamkarasamgraha Of Amrtanamdayogin  v krishnamacharya; Unknown, 1949, the adyar library, 334 pages. Barcode 2020010003866   Scan available.

274. Alang-kaara Kaumudii  Shastrii Esa~ena~; Language. Linguistics. Literature, 1950, Iin'd'iyana~ Yuniversiti Pablishar~sa, 69 pages. Barcode 2030020016392   Scan not available.

275. Alang-kaaramand-haara Trxtiiyo Bhaaga  Parakaalasvaamii Shriikrxshhnd-abrahmatantra; Geography. Biography. History, 1923, Da Gavara~namen't'a~ Brancha~ Presa~, 369 pages. Barcode 2030020016379   Scan not available.

276. Alang-kaaramand-ihaara Chatura~tho Bhaaga  Parakaalasvamii Shriikrxshnd-abrahmatantra; Language. Linguistics. Literature, 1929, Da Gavara~namen't'a~ Brancha~ Presa~, 338 pages. Barcode 2030020016000   Scan not available.

277. Alang-kaaramand-ihaara Chaturtho Bhaaga  shriikrxshhnd-abrahmatantraparakaalasan'yamiindrai; Religion. Theology, 1929, government branch press, mysore, 321 pages. Barcode 5010010024364   Scan not available.

278. Alang-kaaramand-ihaara Da~tiiyo Bhaaga  Parakaalasvamii Shriikrxshhnd-abrahmatantra; Language. Linguistics. Literature, 1921, Da Gavara~namen't'a~ Brancha~ Preasa~, 520 pages. Barcode 2030020015997   Scan not available.

279. Alang-kaaramand-ihaara Dvitiiyobhaaga  shriikrxshhnd-abrahmatantraparakaalasan'yamindai; Language. Linguistics. Literature, 1921, government branch press, mysore, 512 pages. Barcode 5010010025837   Scan not available.

280. Alang-kaaramand-ihaara Prathamo Bhaaga  Parakaalasvaamii Shrii Krxshhnd-abrahmatantra; Religion. Theology, 1917, Da Gavara~nament'a~ Bran'cha~ Presa~, 559 pages. Barcode 2030020016441   Scan not available.

281. Alang-kaaramand-ihaara Prathamo Bhaaga  shriikrxshhnd-abrahmatantraparakaalasan'yamindai; Language. Linguistics. Literature, 1917, government branch press, mysore, 550 pages. Barcode 5010010025839   Scan not available.

282. Alang-kaaramand-ihaara Trxtiiyo Bhaaga  Parakaalasvamii Shriikrxshnd-abrahmatantra; Language. Linguistics. Literature, 1923, Da Gavara~namen't'a~ Brancha~ Presa~, 368 pages. Barcode 2030020015999   Scan not available.

283. Alang-kaaramand-ihaara Trxtiiyobhaaga  parakaalasan'yamiindrai; Language. Linguistics. Literature, 1923, government branch press, mysore, 358 pages. Barcode 5010010024336   Scan not available.

284. Alang-kaaramand-ihaara~ Chatura~tho Bhaaga  Parakaalasvaamii Shriikrxshhnd-abrahmatantra; Language. Linguistics. Literature, 1929, Da Gavara~namen't'a Brancha~ Presa~, 339 pages. Barcode 2030020016398   Scan not available.

285. Alang-kaaramuktaavalii  Paand-d'eya Shriivishveshvara; Geography. Biography. History, 1927, Vidhyaa vilaasa Presa~, 94 pages. Barcode 2030020016378   Scan not available.

286. Alang-karamand-ihaara ,bhaag Iii  r shama sastry; LANGUAGE. LINGUISTICS. LITERATURE, 1923, The Government Branch Press, Mysore, 349 pages. Barcode 5010010078891   Scan available.

287. Alankaara Mand-ihaara Part Iii  shriikrxshhnd-a brahmatantra; LANGUAGE. LINGUISTICS. LITERATURE, 1923, The Government Branch Press , Mysore, 358 pages. Barcode 5010010078259   Scan available.

288. Alankara Sangraha Of Amrtananda Yogin  k bhaskara rao; Unknown, 1984, T.T.D Tirupati, 262 pages. Barcode 2020010003869   Scan available.

289. Alankarakaustubha Of Kavi Karnapura  Lokanatha Chakravarthin; Unknown, 1981, Parimal_Publications, 449 pages. Barcode 2020010003868   Scan available.

290. Alankaramand-ihaara Trxtiiyo Bhaaga  Parakaalasvaamina~ Shriikrxshhnd-abrahmatantra; Religion. Theology, 1923, Da gavara~nament'a Brancha Presa~, 366 pages. Barcode 2030020016304   Scan not available.

291. alankarasarvasva  kasinatha panduranga paraba; Religion, 1893, Nirnaya Sagar Press, Bombay, 566 pages. Barcode 5010010087201   Scan not available.

292. alankarasekhara  kasinatha panduranga paraba; Religion, 1895, Nirnaya Sagar Press, Bombay, 464 pages. Barcode 5010010087186   Scan not available.

293. Alankarathatvascha  Jaggu Venkatachari; Art, 1943, Karonation Mudranalaya,Mysore, 319 pages. Barcode 5010010004347   Server error, availability unknown.

294. Alankaraustubha Of Visvesvara Pandita  Mm.sivadatta; Unknown, 1987, CHAUKHAMBA SANSKRIT PRATISHTHAN, 441 pages. Barcode 2020010010253   Server error, availability unknown.

295. Aldankar Sarvasvam  Gaurinath Sharmana; Unknown, 1926, SRI RAMESHWAR PAATHAKDWARA MUDRITAVA, 134 pages. Barcode 2020010003872   Scan available.

296. All India Oriental Conference Thirteenth Session Nagapur University October 1946  H L Jain; Unknown, 1951, NAGPUR UNIVERSITY, 876 pages. Barcode 2020010003880   Scan available.

297. Aln'kaarakaustubhamuu  shiivadatta; LANGUAGE. LINGUISTICS. LITERATURE, 1898, Tukaram Javaji , Bombay, 443 pages. Barcode 5010010042507   Scan not available.

298. Alphabetical index Of The Sanskrit Manuscripts Vol I  Suranad Kunjan Pillai; Literature, 1957, Trivandrum, 252 pages. Barcode 5010010004445   Server error, availability unknown.

299. Amara Bharathi  Surya Narayana Murty; Unknown, 1983, Bharathi_Sadanamu, 182 pages. Barcode 2020010003890   Scan available.

300. Amara Bharathi Astami Kaksha  Kondapudi Apparao; Unknown, 1986, Government_Of_Andhrapradesh, 242 pages. Barcode 2020010003889   Scan available.

301. Amara Shatakamu  Sri Amaru Kavi; Unknown, 1964, Nirnaya_Sagar_Press, 98 pages. Barcode 2020010003902   Scan available.

302. amarakosa  raghunata shastri; Religion, 1896, Tatva Vivechaka Press, Bombay, 957 pages. Barcode 5010010087202   Scan not available.

303. Amarakosa Namalinganusasanam Of Amarasimha  brahmananda tripathi; Unknown, 1982, chaukhamba surbharathi prakashan, 310 pages. Barcode 2020010003896   Scan available.

304. Amarakosa of Amarasimha  Haragovinda Sastri; Unknown, 1998, Chowkhamba_sanskrit_series_Office, 745 pages. Barcode 2020010010281   Server error, availability unknown.

305. Amarakosah Dwithiya Khandah  -; Unknown, 1939, chowkamba samskruth pusthakalay, 138 pages. Barcode 2020010003894   Scan available.

306. Amarakoshah  sri amar singh; Unknown, 1969, jayakrishna das haridas gupta, 300 pages. Barcode 2020010003897   Scan available.

307. amarakoshhan  Haragovinda Sastri; Literature, 1968, Varanasi, 750 pages. Barcode 5010010004448   Server error, availability unknown.

308. Amarkosh  banerji projesh; The Arts, 1942, kitabistan allahabad, 884 pages. Barcode 2020050058016   Scan not available.

309. Amarkosh Namalingaanusasana  Pandith Haragovinda Sastri; Unknown, 1984, Chowkhamba_Sanskrith_Series_Office, 736 pages. Barcode 2020010003908   Scan available.

310. Amarkosh Pratham Kandam  Viswanath Bhatt; Unknown, 1993, Motilal_Banarsidas, 709 pages. Barcode 2020010003909   Scan available.

311. Amarkosha Of Amarsingh  Ramaswarupa Bholanath Pandit; Unknown, 1952, Khemraj_Shrikrishandass, 314 pages. Barcode 2020010003907   Scan available.

312. Amarzakosha Vigraha Comm  Unknown; Religion. Theology, 999, Unknown, 571 pages. Barcode 5010010010840   Scan not available.

313. Ambikaalaapa Umaalaapa  Not available; Language. Linguistics. Literature, 0, kerala university oriental manuscripts library, 39 pages. Barcode 5010010028158   Scan not available.

314. Amelioration Genetique Des Arbres Forestiers Forets 20  Jean Paul Lanly; Language. Linguistics. Literature, 1985, Organisation Des Nations Unies Pour L Alimentation Et L Agriculture, 328 pages. Barcode 2020050017289   Scan not available.

315. Amerika Bhaaga Pahilaa  Ogale Gurunaathaprabhakara; Geography. Biography. History, 1932, Gurunaathaprabhakara Ogale, 305 pages. Barcode 2030020016373   Scan not available.

316. Amhar Vani (Sathvi Kaksha)  Sri G A V Ms Uppalacharyulu; Unknown, 1986, Andhra_Prabhutvena_Prakashitha, 70 pages. Barcode 2020010003924   Scan available.

317. Amitaa  yashapaala; Language. Linguistics. Literature, 1956, viplava kaaryaalaya, 236 pages. Barcode 5010010012333   Scan not available.

318. Amrau Shatakam  Arjunavarmadeva; Unknown, 2000, CHOUKHAMBA SANSKRIT SERIES OFFICE,VARANASI, 194 pages. Barcode 2020010010287   Server error, availability unknown.

319. amritodaya  kasinatha panduranga paraba; Religion, 1897, Nirnaya Sagar Press, Bombay, 75 pages. Barcode 5010010087249   Scan not available.

320. Amrxtavaand-i  not available; Language. Linguistics. Literature, 1944, Not Available, 104 pages. Barcode 5010010024367   Scan not available.

321. An Anthology Of Poetry And Drama Part I  Dr V Raghavan; Unknown, 1970, SAHITYA ACADEMY, 336 pages. Barcode 2020010003946   Scan available.

322. An Anthology Of Subhashitas Part Two  V Raghavan; Unknown, 1983, SAHITYA ACADEMY, 358 pages. Barcode 2020010003947   Scan available.

323. An Anthology Of The Epics And Puranas  S K De; Unknown, 1959, Sahitya_Academy, 358 pages. Barcode 2020010003948   Scan available.

324. An Indian In Western Europe  Sambu Prasad; Unknown, 1940, Venkat Krishna Rao amp Soni,VIJAYAWADA.,  pages. Barcode 5010010002435   Scan not available.

325. An Introduction To Classical Sanskrit  Shastri Gaurinath Bhattacharyya; LANGUAGE. LINGUISTICS. LITERATURE, 1943, Modern Book Agency, 262 pages. Barcode 8000000003575   Scan not available.

326. An Introdution To The Grammar Of The Sanskrith Language  H H Wilson; Unknown, 1961, The Chowkhamba Sanskrith Series Office, 524 pages. Barcode 2020010004109   Scan available.

327. An'bigara Chaud'ayyana Vachanagal'u  en' . jiivana; LANGUAGE. LINGUISTICS. LITERATURE, 1958, A.M.Karadi Book Sellers , Hubli, 30 pages. Barcode 5010010043058   Scan available.

328. An'cdhaa Yuga Samiiqs-a  pro laqs-mand-adata gautama; Language. Linguistics. Literature, 1968, ashooka prakaashana, 139 pages. Barcode 5010010012481   Scan not available.

329. Anaghraaghavamu  sriilaqs-mand-asuurivirachitayaa; LANGUAGE. LINGUISTICS. LITERATURE, 1900, sriimattjjaangarei viraajagaanaayaamuu srii puund-ichandreidaya mudraaqs-rashaalaayaamuu, 340 pages. Barcode 5010010078851   Scan available.

330. Ananda Ramayana  Dr.aruna Gupta; Unknown, 1984, Eastern Book Linkers, 268 pages. Barcode 2020010003939   Scan available.

331. Anandanandini  Chandra Sekhara Sharma, M; Literature, 1999, M. Chandra Sekhara Sharma, Hyderabad, 233 pages. Barcode 5010010004468   Server error, availability unknown.

332. Anandashram Sanskrith Granthavali Trishtlisethu  Narayan Bhatt; Unknown, 999, -, 388 pages. Barcode 2020010003940   Scan available.

333. Anandashramasanskruthagranthavalihi  Kuttakarshiromani; Literature, 1866, Anadashrama Mudranalaya, 66 pages. Barcode 5010010004469   Server error, availability unknown.

334. Anandasramsanskritgradhavali  V.s.s.r.snankarsastri marulkar; Literature, 1995, Ananda mudranalay, 375 pages. Barcode 5010010006751   Scan not available.

335. Anandasundari  Prof. A N Upadhye; Unknown, 1955, MOTILAL BANARSIDAS, 130 pages. Barcode 2020010003941   Scan available.

336. Anandh Samastha Granthavali  Shriman Mahadev Chmanji Aftee; Unknown, 1864, Anandh ShamanGrandhlaya, 136 pages. Barcode 2020010003943   Scan available.

337. Anang-garang-ga Kaamakalaa Hindiivyaa Gopaniiyama  mahaakavikalyaand-amalla; Language. Linguistics. Literature, 1973, chaukhambha sanskrit sansthan, vaaraand-asi, 100 pages. Barcode 5010010025653   Scan not available.

338. Ananthabharathi  dr. r. ananthakrishna sharma; Language. Linguistics. Literature, 1977, surabharathi prakashanam, bangalore, 54 pages. Barcode 5010010025654   Scan not available.

339. Anara~gharaaghavama~ Trxtiiyo San'skarand-ama~  Shriimuraarimishra Mahaakavii; Language. Linguistics. Literature, 1936, Vaachaspatyayantre Mudritama~, 468 pages. Barcode 2030020016388   Scan not available.

340. Anargharaaghavamuu  d'urghaprasaada; LANGUAGE. LINGUISTICS. LITERATURE, 1937, Nirnaya Sagar Press , Bombay, 399 pages. Barcode 5010010042551   Scan not available.

341. Ancient Indian Economic Thoughts  Dr Ram Naresh Tripathi; Unknown, 1981, Vohra Publications And Distributions, 400 pages. Barcode 2020010003956   Scan available.

342. and-ubhaashhyamu  H P Malledevaru; Unknown, 1985, Oriental Research Institute Mysore, 459 pages. Barcode 5010010004528   Server error, availability unknown.

343. Andhra Baghvath Parimal  varnasi ramamurty renu; Language. Linguistics. Literature, 1964, andhra pradesh saahitya akademy hyderabad, 254 pages. Barcode 2020050057990   Scan not available.

344. Andhra Bhagvthanuvad  Shiromani Sannidhanam Suryanarayanshastry; Unknown, 1971, Dakshin_Bharath_Press, 168 pages. Barcode 2020010003962   Scan available.

345. Andhradesiahasyakatha  suryanarayana shastri; Language. Linguistics. Literature, 1964, andhra sahitya akademy hyderabad, 82 pages. Barcode 2020050057962   Scan not available.

346. Anekaara~thatilaka  Mahiipa; General, 1947, Kaatre, 242 pages. Barcode 2030020016155   Scan not available.

347. Anekaathara~tilaka  Mahiipa; Language. Linguistics. Literature, 1947, Punaa, 239 pages. Barcode 2030020016063   Scan not available.

348. Anekartha Sangraha  acharya hema chandra; Language. Linguistics. Literature, 1929, jai krishnadas haridas gupta varnasi, 224 pages. Barcode 2020050036047   Scan not available.

349. Anekartha Tilaka Of Mahipa  Madhukar Mangesh Patkar; Unknown, 1947, Deccan_College_Postgraduate_ _Research_Institute, 236 pages. Barcode 2020010004095   Scan available.

350. Annamacharya And Surdas  Jaganadha Rao, Mamchala; Ttd,tirupati, 1979, T.T.D Tirupati, 377 pages. Barcode 5010010006594   Scan not available.

351. Annanda Sramasamskrutha Grandavali  Mr.kale; Unknown, 1990, MOTILAL BANARSI DASS, 258 pages. Barcode 2020010010540   Server error, availability unknown.

352. Anthya Karmadeepika  Nithyananda Parvathiya; Unknown, 1952, Choukamba Samskruth Pusthakalay, 168 pages. Barcode 2020010004124   Scan available.

353. Anu Bhashya  Vallabhacharya; Art, 1921, Sri Raghavendra Ashrama Bangalore, 495 pages. Barcode 5010010000365   Scan not available.

354. anubhaashhyagaan'bhiiryagran'tha  raamasubramand-ya shaastriind-a; Literature, 1912, Sri Venkateswara Printing press , Mumbai, 64 pages. Barcode 5010010092082   Scan available.

355. Anubhaashya Baalaboodinii Bhaaga 2  shriimadvallabhaachaarya; Language. Linguistics. Literature, 1926, Not available, 504 pages. Barcode 5010010024385   Scan not available.

356. Anubhuutiprakaasha  shriimadvidhyaarand-ayasvaami; Religion. Theology, 1983, munshiiraama manoharalaala pablisharsa pra li, 194 pages. Barcode 5010010024386   Scan not available.

357. anubhuutiprakaasha  Sri Vidyaranya; Philosophy. Psychology, 0, Not Available, 92 pages. Barcode 5010010026501   Scan not available.

358. Anumana Pramana  Dr Bali Ram Shukla; Unknown, 1986, Eastern Book Linkers, 444 pages. Barcode 2020010004128   Scan available.

359. Anustana Prakasaha Mahanibandhaha  Unknown; Religion. Theology, 1991, Unknown, 762 pages. Barcode 5010010010843   Scan not available.

360. Anusuchi  Vethanamanom; Unknown, 1976, Shasan Kendriya Mudranalay, 280 pages. Barcode 2020010004133   Scan available.

361. Anuvaad Kala  charu deva shastry; Language. Linguistics. Literature, 1950, motilal banarsidass, 274 pages. Barcode 2020050036390   Scan not available.

362. Anuvaada Kalaa Athavaa Vaga~vyavaharadara~sha  Shaastrii Shriichaarudevashaastii; Philosophy. Psychology, 1950, Jaanakii Sharand-a Tripaat'ii Sura~ya Presa~, 277 pages. Barcode 2030020016484   Scan not available.

363. Anuvrath Vidhya Trishati  Vidwan Shivasri; Unknown, 1989, Shivasri Vidhya Sevasamstha, 72 pages. Barcode 2020010004135   Scan available.

364. anyottayullaasan  H.p.malledevaru; Literature, 1985, Oriental Research Institute Mysore, 143 pages. Barcode 5010010004529   Server error, availability unknown.

365. Apabhran'shakaavyatrayii  Jindaattasuurii; Language. Linguistics. Literature, 1927, Tatva Vivechaka Presa~, 262 pages. Barcode 2030020016550   Scan not available.

366. Apaharvarma Charita  Ved Prakash Shastri; Unknown, 999, Sanmarg Prakashan, 122 pages. Barcode 2020010004139   Scan available.

367. Aparajitaprccha Of Bhuvanadeva  Popatbhai Ambashankar Mankad; Unknown, 1950, Oriental Institute, 720 pages. Barcode 2020010004140   Scan available.

368. Aparoqs-aanubhuuti Savyaaravyaa  Not available; Language. Linguistics. Literature, 0, Not available, 320 pages. Barcode 5010010024390   Scan not available.

369. Apastamba s Aphorisms  george buhler dr; Religion. Theology, 1932, m g shastry bombay, 312 pages. Barcode 2020050057983   Scan not available.

370. Apastambagrihya Sutra  A Chinna Swami Shastrulu; Unknown, 1928, Jai Krishnadas Haridas Gupta, 346 pages. Barcode 2020010004144   Scan available.

371. Apastambagrxhyasuutran  A. Chinnaswami Sastri; Language. Linguistics. Literature, 1928, Jaya Krishnadas Haridas Gupta, Benares, 346 pages. Barcode 5010010029026   Scan not available.

372. Apastambasrautasutra Dhurtasvamibhasya  Pandith A Chinnaswami Sastri; Unknown, 1955, Oriental Institute, 552 pages. Barcode 2020010004145   Scan available.

373. Apasthamba Sulba Sutra  D Srinivasacharya; Unknown, 1931, The Governmenrt Press Mysore, 346 pages. Barcode 5010010000370   Server error, availability unknown.

374. Aprakaashitaa Upanishhadah  Kunj-chanaraaja Chi Dakt'ara~; Religion. Theology, 1923, An'd'ayaara~pustakaalaye, 540 pages. Barcode 2030020016263   Scan not available.

375. Ar^thasan'graha  Sri Laugakshibhaskara; Philosophy. Psychology, 1915, Tukaram Javaji, 138 pages. Barcode 5010010029902   Scan not available.

376. ar^thashaastram' Part I  Sri Ganapathy Sastri; SOCIAL SCIENCES, 1924, Sri Rama Varma, 384 pages. Barcode 5010010033754   Server error, availability unknown.

377. Ar^thashaastram' Part Iii  Sri Ganapathy Sastri; Social Sciences, 1925, Sri Rama Varma, 400 pages. Barcode 5010010033717   Scan not available.

378. ar^thashaastrapadasuchii Part III  R. Shama Sastri; SOCIAL SCIENCES, 1925, Govt. Of Mysore, 350 pages. Barcode 5010010031185   Server error, availability unknown.

379. aramelakalanidi  Ramaswami Aiyar; Literature, 1932, The Annamalai University, 145 pages. Barcode 5010010004537   Server error, availability unknown.

380. Ara~tha Shaastra Padasuuchii Dditiiyo Bhaaga  Shaastri Shamaa; Social Sciences, 1925, Oriend-t'ala Laibrarii Pablikeshansa, 459 pages. Barcode 2030020016174   Scan not available.

381. Ara~tha Shaastra Padasuuchii Prathamo Bhaaga  Shaastri Shamaa; Social Sciences, 1924, Oriend-t'ala Laibrari Pablikeshansa, 469 pages. Barcode 2030020016200   Scan not available.

382. Ara~thashaastrapadasuuchii Prathamo Bhaaga  Shaastrii Shaamaa; Social Sciences, 1924, Kaut'ilyaa Ara~thashaastra, 469 pages. Barcode 2030020016035   Scan not available.

383. Archaavaatara Vaibhavam  pandit r v krishnamaachaarya; Religion. Theology, 1921, rao bahadur t namberumal chetty madras, 88 pages. Barcode 5010010018023   Scan not available.

384. Architecture Of Manasara  prasanna kumar acharya; Unknown, 999, oxford university press, 865 pages. Barcode 2020010004157   Scan available.

385. Ardh Srimadbagavathardha Dharsan  -; Unknown, 999, -, 896 pages. Barcode 2020010004162   Scan available.

386. Ardh Srimadbagavathardha Dharsan Vol 1  -; Unknown, 999, -, 986 pages. Barcode 2020010004161   Scan available.

387. Arpand-a Patrikaa  Not available; Language. Linguistics. Literature, 0, Not available, 258 pages. Barcode 5010010017964   Scan not available.

388. Artha Sastra Of Koutilya  Ganapati Sastri.t; History, 1924, GOVT PRESS,TRIVADRUM,  pages. Barcode 5010010002788   Scan not available.

389. arthasagraha'  laugakshi bhaskara; Religion, 1882, Benares Printing Press, Beneras, 94 pages. Barcode 5010010087234   Scan not available.

390. Arthasamgraha  shri laugakshi bhaskara; Language. Linguistics. Literature, 1931, the bombay book depo bombay, 258 pages. Barcode 2020050036394   Scan not available.

391. Arthasastra Of Kautilya  R Shama Sastry; Unknown, 1924, The_Government_Bransh_Press, 492 pages. Barcode 2020010004171   Scan available.

392. Arthasatra Of Kautilya Vol Ii  J Jolly; Unknown, 1924, Motilal_Banarsidas, 330 pages. Barcode 2020010004172   Scan available.

393. Arthavedatdhasamhitha  Ramachandra Sharma; Unknown, 1955, Sanathana_dharma Yantharanalay, 588 pages. Barcode 2020010004174   Scan available.

394. Arthvaved Sanhita  Ramchandra Sharmane; Unknown, 2000, Sanatandharm Yantralay, 472 pages. Barcode 2020010004179   Scan available.

395. Arya Salistamba Sutra  N Aiyaswami Sastri; Unknown, 1950, Adyar_Library, 158 pages. Barcode 2020010004197   Scan available.

396. Arya Salistambe Sotra  Srinivasa Murti; History, 1955, THE ADYAR LIBRARY SEIRIES,ADYAR, 157 pages. Barcode 5010010000379   Scan not available.

397. Arya San'graha  vaachaspatii upaadyaaya; Language. Linguistics. Literature, 1990, Chowkamba Orientalia , Delhi, 291 pages. Barcode 5010010025657   Scan not available.

398. Aryavidya Sudhakara  Yajneswara Cimana Bhatta; Unknown, 1940, Motilal_Banarsi_Dass, 248 pages. Barcode 2020010004200   Scan available.

399. Asalayina Gruhasutram  Unknown; Religion. Theology, 999, Unknown, 473 pages. Barcode 5010010010842   Scan not available.

400. Asalii Tejii Mandii Sat't'aa  raajya jyootishhi pan' devaraaja jii; General, 0, ratana end-d'a kampanii, 139 pages. Barcode 5010010012510   Scan not available.

401. asatmatattvodhyotaprakarand-amu  Lakshminarayana; Religion, 1955, Majestic_Press_Udipi, 871 pages. Barcode 5010010004570   Server error, availability unknown.

402. Ashht'aaadashapuraand-aparichaya Pauraand-ikaprabhaaparishiilanamu  d'aa shriikrxshhnd-amand-itripaat'hii; Religion. Theology, 1980, chaukhambaa sarasvatiibhavana, vaaraand-asii, 252 pages. Barcode 5010010024391   Scan not available.

403. ashht'aad'asagrand'aha  Athridev Gupta; Religion, 1951, Nirnaysagar_Mudranalaya_Mumbai, 448 pages. Barcode 5010010004565   Server error, availability unknown.

404. Ashht'aadashapuraand-a Darpand-a  Not available; Religion. Theology, 1844, laqs-miiven'kat'eshvara chhaapekhaana mun'bayii, 432 pages. Barcode 5010010024392   Scan not available.

405. Ashht'aadashasmrxtaya Ang-gira Aadi 18 Smrxtiyon' Kaa San'graha  Not available; Religion. Theology, 1998, sastaa san'skrxta saahitya mand-ad'ala shaamalii, 142 pages. Barcode 5010010024393   Scan not available.

406. Ashht'aan'gatddadayamu Suutra Shariira Nidaana Chikitsaa Kalpa Uttarasthaanavibhaktamu  shriimadvaagbhat't'a; Language. Linguistics. Literature, 1912, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 672 pages. Barcode 5010010025659   Scan not available.

407. ashht'adashapuraand-a darpaind-a  Athridev Gupta; Religion, 1935, Sri_Venkateswara_Steam_Press_Mumbai, 438 pages. Barcode 5010010004566   Server error, availability unknown.

408. ashht'adashapuraand-aparichayan  Sri Krishna Tripati; Religion, 2002, Bharathiya Sahitya Vidyalaya Varanasi, 182 pages. Barcode 5010010000398   Server error, availability unknown.

409. Ashht'adashashmutuyahan  Unknown; Unknown, 999, Unknown, 292 pages. Barcode 5010010010838   Scan not available.

410. ashht'adashasmrxtaya  Sri Krishnadas; SOCIAL SCIENCES, 1830, Sri Venkateswara, 506 pages. Barcode 5010010033834   Server error, availability unknown.

411. ashht'adhyaayii bhaashhya pradamaavuti  Yudishtar Mimamasat; Literature, 1500, no, 789 pages. Barcode 5010010006665   Scan not available.

412. Ashht'apraasashatakatrayamu  Sri G Ramaswami Sastrigal; Language. Linguistics. Literature, 1960, R Hariharasubramani Madras, 95 pages. Barcode 5010010012742   Scan not available.

413. Ashtadyayi Sutrapaat  Swamy Pramodgiri Vedanthkishore; Unknown, 999, CHOUKHAMBA ACADEMY ,VARANASI, 247 pages. Barcode 2020010010636   Server error, availability unknown.

414. Ashtajai Bhashya Pradamavruti  -; Language. Linguistics. Literature, 1968, pyarelal kapoor, 800 pages. Barcode 2020050058025   Scan not available.

415. Ashtan'daghadhyaayam  kaviraj shrii athrii dhev guru; Language. Linguistics. Literature, 0, jaikrushnadas haridas press, 630 pages. Barcode 2020050058050   Scan not available.

416. Ashtanga Samgraha  Dhamodar; Unknown, 999, -, 1064 pages. Barcode 2020010010637   Server error, availability unknown.

417. Ashtangahridaya  vagbhatta; Language. Linguistics. Literature, 0, Not available, 254 pages. Barcode 5010010028159   Scan not available.

418. Ashvinao Devtaki Bhoomika  Sripad Damodar Satvalekar; Unknown, 1948, Sri_Satvalekar_Publishing_ _Co.,, 458 pages. Barcode 2020010004221   Scan available.

419. Astaangahridaya  vaagbhata; Technology, 1939, Pandurang Jaawaji Bombay, 1146 pages. Barcode 2020050043615   Scan not available.

420. Astadasasmrtayah  Somraj Krishna Das; Unknown, 1951, Sri Venkateshwara Steam Press, Mumbai, 289 pages. Barcode 5010010010839   Scan not available.

421. Astadhyayisutrapatha  Maharshi Panini; Unknown, 1998, Choukhambha_Publishers, 367 pages. Barcode 2020010010651   Server error, availability unknown.

422. Astam- Puspam- Vivaram-vranam  P.vishnuteertha; Religion, 1955, , 130 pages. Barcode 5010010006667   Scan not available.

423. astanga hridayam  harinaaraayand-a sharma; Religion, 1921, , 916 pages. Barcode 5010010087191   Scan not available.

424. Astanu Hrudayam  Shiva Sharma; Literature, 1928, Shiva Sharma, Patiala, 562 pages. Barcode 5010010000401   Scan not available.

425. Asthadhyayisutrapaath  Acharya Sri Sitaram Shastri; Unknown, 1951, Bhargav_Pustakalay, 234 pages. Barcode 2020010004225   Scan available.

426. asvaalayaana gruhama suutramu  Ramalingam,m; , 1936, M. Ramalingam, Chennai., 279 pages. Barcode 5010010007264   Scan not available.

427. Asvalayaand-a Graha Suutraa Vol I  Tira~tha Svaami Ravi; Religion. Theology, 1944, The Adyar Library, 257 pages. Barcode 2030020016042   Scan not available.

428. Asvalayanagrhyasutra Bhasyam Of Devasvamin  Pandith K P Aithal; Unknown, 999, The_Adyar_Library_And_Research_Centre, 362 pages. Barcode 2020010004230   Scan available.

429. Asvasastram  Nakula; Unknown, 1952, T_M_S_S_M_Library, 310 pages. Barcode 2020010004231   Scan available.

430. Asvasastram  dr p srinivaasarao; Language. Linguistics. Literature, 1950, government oriental manuscripts library madraas, 156 pages. Barcode 5010010018024   Scan not available.

431. Asya Vamasya Hymn  Dr.c.kunhan Raja; Unknown, 1956, Ganesh Co.,Private Limited, 266 pages. Barcode 2020010004232   Scan available.

432. Atakam  Acharya Sri Pandith Laxmanlal; Unknown, 1983, KRISHNADAS ACADEMY, 146 pages. Barcode 2020010005923   Scan available.

433. Ath Koormmahapuranam Prarabhyate  Sri Venkatesho Vijaytetram; Unknown, 999, Sri_Venkateshwar_Steem_Press, 340 pages. Barcode 2020010004237   Scan available.

434. Ath Shuklayajurvedakavya Samhitha  Shri Anand Van Aagadi; Unknown, 999, Shri_Anand_Van_Aagadi, 404 pages. Barcode 2020010004244   Scan available.

435. Ath Srimaddwaramahapuranam  Shri Anand Van Aagadi; Unknown, 1987, Bamoojab_Yantralay, 520 pages. Barcode 2020010004245   Scan available.

436. Ath Srimnmatsyamahapuranam Prarbhyate  -; Unknown, 999, Laxmi_Venkateshwar_Mudranalay, 650 pages. Barcode 2020010004246   Scan available.

437. Ath Sriskanandmahapuranam  -; Unknown, 1965, Sri_Venkateshwar_Mudranalay, 696 pages. Barcode 2020010004247   Scan available.

438. Ath Sriskand Mahapurane Brahmkhande Sethumahatmay Vol I I I  -; Unknown, 999, Steem_Yantralay_Mudranalay, 436 pages. Barcode 2020010004250   Scan available.

439. Ath Sriskande Mahapurane Shanst Nagar Khand I I I  -; Unknown, 999, Sri_Venkateshwar_Mudranlay, 668 pages. Barcode 2020010004248   Scan available.

440. Ath Sriskande Mahapuranm Vaisnavkhande Venkatachalammahatmay Vol I I  -; Unknown, 999, Steem_Mudranalay, 666 pages. Barcode 2020010004249   Scan available.

441. Ath Vishnudharmottar Mahapuranam  -; Unknown, 999, Sri_Venkateshwar_Yantralay, 986 pages. Barcode 2020010004251   Scan available.

442. atha aparokshhaanishrutipraaran'bhyate  Not available; Literature, 1856, Not available, 32 pages. Barcode 5010010092067   Scan available.

443. atha brahmaand-dhamahaapuraand-a praarabhyate  -; RELIGION. THEOLOGY, 1921, -, 155 pages. Barcode 2020050088381   Scan available.

444. Atha Bruhjjyaatishhaand-aivaishhashht'omishhrasakandhochakaavalisan'grahaa  Somraj Krishna Das; Unknown, 1867, Sri Venkateshwara Steam Press, Mumbai, 311 pages. Barcode 5010010010812   Scan not available.

445. Atha Dugaipaasanaakalpadgumaavishhayaanukramand-ikaa  Unknown; Religion. Theology, 1995, Unknown, 474 pages. Barcode 5010010010811   Scan not available.

446. Atha Gaayatrii Tantra  Baladevaprasaada; Religion. Theology, 1955, Laqs-miivenkateshvara St'iima~ Presa~, 106 pages. Barcode 2030020016248   Scan not available.

447. Atha Govidrchanaa Chandrikaa  Somraj Krishna Das; Unknown, 1962, Sri Venkateshwara Steam Press, Mumbai, 974 pages. Barcode 5010010010797   Scan not available.

448. Atha Gurubhavaprakaashikaa Rukminishaa Vijayamu  Ramachandra Savath; Unknown, 1892, Sri Ramatatva Prakasha, 466 pages. Barcode 5010010010796   Scan not available.

449. Atha Haayanarantapurvaihai  Unknown; Religion. Theology, 999, Unknown, 278 pages. Barcode 5010010010791   Scan not available.

450. Atha Jaatakaabharand-an' Praarabyate  not Available; Language. Linguistics. Literature, 0, Not Available, 196 pages. Barcode 5010010028317   Scan not available.

451. Atha Kaasi Khandaa Dhvitiyo Bhaagan  Unknown; Unknown, 999, Unknown, 379 pages. Barcode 5010010010786   Scan not available.

452. Atha Kalikaa Puraand-amu  Somraj Krishna Das; Unknown, 1948, Sri Venkateshwara Steam Press, Mumbai, 621 pages. Barcode 5010010010789   Scan not available.

453. atha kiiraanya keshoyammatrasamhitaa  ; Literature, 999, , 177 pages. Barcode 5010010006680   Scan not available.

454. Atha Krumaimahaapurand-an  Sri Krishna Das; Unknown, 999, Sri Venkateshwara Steam Press, Mumbai, 338 pages. Barcode 5010010010784   Scan not available.

455. atha laghushabdendushekhara  Not available; Literature, 1869, Not available, 224 pages. Barcode 5010010092031   Scan available.

456. Atha Maanasasaqs-aipaddatii  Somraj Krishna Das; Unknown, 999, Sri Venkateshwara Steam Press, Mumbai, 213 pages. Barcode 5010010010768   Scan not available.

457. atha pradhamaadi chaturdaishaadhyaayaanaan  H.a. Treble; Literature, 1929, Macmillan And Co,Limited,London, 267 pages. Barcode 5010010004594   Server error, availability unknown.

458. Atha Pradhamamudrand-akaalikiiprastaavanikaa  Unknown; Religion. Theology, 1965, Unknown, 558 pages. Barcode 5010010010798   Scan not available.

459. Atha Pramaand-apudvatan  Unknown; Unknown, 1917, Modern Printing Press, Madras, 195 pages. Barcode 5010010010743   Scan not available.

460. Atha Saamaanyakakqs-and-aa Prakarand-amu  Not Available; Language. Linguistics. Literature, 0, Not Available, 810 pages. Barcode 5010010028162   Scan not available.

461. atha sabhaashhaat'iika shriimaakand-ng-eyapuraand-amuu  -; RELIGION. THEOLOGY, 1920, -, 356 pages. Barcode 2020050088361   Scan not available.

462. atha sart'aakamaatmapuraand-a praaran'bhyate  Not available; Literature, 1876, Not available, 1038 pages. Barcode 5010010091989   Scan available.

463. Atha Shikqs-aadiveidaang-gachatushhuta Praaran'bha  not available; Language. Linguistics. Literature, 0, Not Available, 46 pages. Barcode 5010010028318   Scan not available.

464. atha shraamadbhagavataan't'oppand-ii chet'tityaakhyaa  H.a. Treble; Literature, 1929, Macmillan And Co,Limited,London, 512 pages. Barcode 5010010004600   Server error, availability unknown.

465. atha shraamadbhagavataan't'oppand-ii man'danan'diniisaptaman' sn'kadhan  H.a. Treble; Literature, 1929, Macmillan And Co,Limited,London, 258 pages. Barcode 5010010004596   Server error, availability unknown.

466. Atha Shriibhaavataat'appand-ii Satyadhamayan'tikrutaa  Savanur,g.r; Unknown, 1858, G.R. Savanur, Dhrwar, 348 pages. Barcode 5010010010831   Scan not available.

467. Atha Shriibhaavataat'appand-ii Satyadhamayan'tikrutaadvadaso Kandhan  Somraj Krishna Das; Unknown, 1867, Sri Venkateshwara Steam Press, Mumbai, 638 pages. Barcode 5010010010824   Scan not available.

468. Atha Shriikaalalokprakaasho Ashht'avishatitaman  Unknown; Religion. Theology, 999, Unknown, 342 pages. Barcode 5010010010779   Scan not available.

469. Atha Shriikaashakhid'an' Puvaathai  Unknown; Religion. Theology, 999, Unknown, 602 pages. Barcode 5010010010785   Scan not available.

470. Atha Shriimadbhagavadgiitaa  Not available; Language. Linguistics. Literature, 0, raamatatvaprakaasha chapaakhaanaa, 620 pages. Barcode 5010010012656   Scan not available.

471. atha shriimadbhagavate ashht'amaskan'dhan  H.a. Treble; Literature, 1929, Macmillan And Co,Limited,London, 342 pages. Barcode 5010010004598   Server error, availability unknown.

472. atha shriimaddaayumahaapuraand-a praarakyate  -; RELIGION. THEOLOGY, 1920, -, 356 pages. Barcode 2020050088368   Scan available.

473. atha shriimadhbagavataa vijayadavaaja ekaadasobhaagan  H.a. Treble; Literature, 1929, Macmillan And Co,Limited,London, 390 pages. Barcode 5010010004597   Server error, availability unknown.

474. Atha Shriimadhyaayasudhaat'ippand-i  Unknown; Unknown, 999, Unknown, 342 pages. Barcode 5010010010750   Scan not available.

475. atha shriimadvagavate dvadashaskan'dha  H.a. Treble; Literature, 1929, Macmillan And Co,Limited,London, 88 pages. Barcode 5010010004595   Server error, availability unknown.

476. atha shriimanmatsyamahaapuraand-a praarakyayate  -; RELIGION. THEOLOGY, 1922, -, 224 pages. Barcode 2020050088372   Scan available.

477. Atha Shriimannyaayasudhaa  Unknown; Unknown, 999, Unknown, 203 pages. Barcode 5010010010751   Scan not available.

478. Atha Shriimannyaayasudhaa  Unknown; Unknown, 999, Unknown, 197 pages. Barcode 5010010010752   Scan not available.

479. Atha Shriimannyaayasudhaa  Unknown; Unknown, 999, Unknown, 327 pages. Barcode 5010010010753   Scan not available.

480. atha shriimudgalpuraand-an  H.a. Treble; Literature, 1929, Macmillan And Co,Limited,London, 1093 pages. Barcode 5010010004601   Server error, availability unknown.

481. Atha Tatpurusha Prakaranam  ; Literature, 999, no, 474 pages. Barcode 5010010000417   Scan not available.

482. Atha Tatpurusha Prakaranam  ; Literature, 0, , 483 pages. Barcode 5010010000418   Server error, availability unknown.

483. Atha Tatpurusha Prakaranam  ; Linguistics Literature, 999, ,  pages. Barcode 5010010002485   Scan not available.

484. Atha Tatpurushhaprakarand-amu  not available; Language. Linguistics. Literature, 0, Not Available, 484 pages. Barcode 5010010028164   Scan not available.

485. Athaa Hymaratanaa Baalabhaadraa  Unknown; Religion. Theology, 999, Unknown, 184 pages. Barcode 5010010010792   Scan not available.

486. athaaprabdhanoyaanamimaan'saa  Venkatachala Sastry; Literature, 1959, Sri_Venkateswara_Press_Mumbai, 206 pages. Barcode 5010010004334   Server error, availability unknown.

487. athabadariimaahaatmya  Gangavishnu amp Khemaraj; Religion, 1898, Gangavishnu_Srikrishnadas,Mumbai, 64 pages. Barcode 5010010000439   Server error, availability unknown.

488. Athabrahaapuraand-asithatavishhayaanukramand-ikha  Somraj Krishna Das; Unknown, 1963, Sri Venkateshwara Steam Press, Mumbai, 579 pages. Barcode 5010010010813   Scan not available.

489. athabrahaasutrabhaashhyan  Shankar Panduranga Pandit; Literature, 1989, Krishnadas_Academy_Varanasi, 352 pages. Barcode 5010010004591   Server error, availability unknown.

490. athachan'puuraamaayand-a praaran'bhah  naaro apaajii; Literature, 1881, Apalya Press , Poone, 114 pages. Barcode 5010010092042   Scan available.

491. Athagreya Mahapuranam  Unknown; Religion. Theology, 1977, Unknown, 547 pages. Barcode 5010010010837   Scan not available.

492. athaharitaalikaapuujaasaarthakathaapraaran'bhah  Not available; Literature, 1865, Not available, 60 pages. Barcode 5010010092016   Scan available.

493. Athaitareyopatishhatu  sadaachaara; Language. Linguistics. Literature, 0, Not available, 627 pages. Barcode 5010010012378   Scan not available.

494. athakaalamairavaapt'akapraaran'bhah  Not available; Literature, 1897, Not available, 306 pages. Barcode 5010010092071   Scan available.

495. athakaarikaavaliimuktaavaliidinakariisahitaraamarudriipraaran'bhah  Not available; Literature, 1869, Not available, 460 pages. Barcode 5010010091932   Scan available.

496. Athamn'tramahodadhigranthasyasyaivashhayaanukramand-ikaa  krishna Das,k; Unknown, 999, Sri Venkateshwara Steam Press, Mumbai, 565 pages. Barcode 5010010010771   Scan not available.

497. Athamn'tramahodadhit'okaanokaayan'trasahita  Unknown; Language. Linguistics. Literature, 999, Unknown, 353 pages. Barcode 5010010010773   Scan not available.

498. athanirnd-ayasin'ghvanikamand-ikaapraaran'bhaayam  baapu sadaashiva; Literature, 1883, Not available, 600 pages. Barcode 5010010091937   Scan available.

499. athapan'chakoshiimaahaatmyan'praaramyate  Not available; Literature, 1867, Not available, 52 pages. Barcode 5010010092073   Scan available.

500. athapushhvaramaahaaramya praaran'bhah  shriidhara shivalaala; Literature, 1890, Not available, 83 pages. Barcode 5010010092172   Scan available.

501. Atharavaanaa Upanishhada Second Edition  Jacob G A; Religion. Theology, 1916, Govt Central Press, 214 pages. Barcode 2030020016020   Scan not available.

502. Athara~va Pratishaakhyama~ Prathamogyan' Bhaaga  Ityupaadhidhaarind-aa Ema O Ela; Religion. Theology, 1923, A C Woolner Esq, 100 pages. Barcode 2030020016047   Scan not available.

503. Athara~vavedasan'hitaa Trxtiiyobhaagaa  saayand-aachara~ya; Religion. Theology, 1898, Javaji Daadajisa~ Nira~nayaa Sagara~ Pressa~, 867 pages. Barcode 2030020016206   Scan not available.

504. Athara~vavediiyaa Brxhatsara~vaanukramand-ika  Shaastrii Raamagopaala; Religion. Theology, 1922, Hindii Presa~, 288 pages. Barcode 2030020016300   Scan not available.

505. Athara~vedasan'hitaa Bhaaga 2  Saayand-aachara~yaa; Religion. Theology, 1895, Javaji Daadaajisa~ Nira~naya~ Sagara~pressa~, 263 pages. Barcode 2030020016212   Scan not available.

506. Atharva Vedha Samhita Mulya Mantra Sayaye Bhashya Kshiks Kandah  Rama Chandra Sharma; Unknown, 9999, Sanathana_Dharma_Yantralay, 594 pages. Barcode 2020010004235   Scan available.

507. Atharva Vedha Samhitha  Damodar Sathwalekar; Unknown, 999, Swasthata_Mandal, 555 pages. Barcode 2020010004236   Scan available.

508. atharvaipraatishaakhayamu  Surya Kantha; Literature, 1939, Mehar Chand Lachhman Das Publishers, Lahore, 398 pages. Barcode 5010010004584   Server error, availability unknown.

509. Atharvaveda San'hitaa  saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa; Language. Linguistics. Literature, 1860, aundharaajadhaanyaan' bhaaratamudrand-aalaya, 538 pages. Barcode 5010010024397   Scan not available.

510. Atharvaveda San'hitaa  saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa; Language. Linguistics. Literature, 1860, aundharaajadhaanyaan' bhaaratamudrand-aalaya, 554 pages. Barcode 5010010025663   Scan not available.

511. Atharvavedasan'hitaa Bhaaga 3  saayand-aachaarya; Religion. Theology, 1898, jaavajii daadaajii nirnd-ayasaagara mudrand-aalayamu, 856 pages. Barcode 5010010017731   Scan not available.

512. Atharvaveida San'hita  bhat't'aachaarya; Religion. Theology, 0, Not available, 460 pages. Barcode 5010010024398   Scan not available.

513. Atharvaveida San'hitaa Rxshhyaadi Savalitaa  Not available; Language. Linguistics. Literature, 1957, aarya saahitya mand-d'ala limit'ed'a aajameira, 600 pages. Barcode 5010010017356   Scan not available.

514. Atharvaveidasan'hitaa Bhaaga 4  saayand-aachaarya; Language. Linguistics. Literature, 0, jaavaajii daadaajii, mun'bayyaan', 475 pages. Barcode 5010010017732   Scan not available.

515. athasaambapuraand-an'praaramyate  khemaraaja shriikrxshhnd-adaasa; Literature, 1896, Sri Venkateswara Printing press , Mumbai, 247 pages. Barcode 5010010091972   Scan available.

516. athasaarthashriimadashhtyand-apraaran'bhah  Not available; Literature, 1896, Not available, 524 pages. Barcode 5010010091978   Scan not available.

517. Athashriibhaagavatat'ippand-ii Satsadhamaikrutaa  Savanur,g.r; Unknown, 1858, G.R. Savanur, Dhrwar, 395 pages. Barcode 5010010010830   Scan not available.

518. Athashriibhaagavatat'ippand-ii T'ikaa Shriidharaa  Unknown; Unknown, 999, Unknown, 549 pages. Barcode 5010010010822   Scan not available.

519. Athashriibhagavathat'ippanii Karmakat'ikaa Vijayavaad'aa Tirtaa Trayodase Kandan  Unknown; General, 999, Unknown, 370 pages. Barcode 5010010010823   Scan not available.

520. athashriibrahmavaivarta mahaapuraand-an' praaran'bhah  shrii krxshhnadaasa; Literature, 1888, Sri Lakshivenkateswara Chapkhana, 502 pages. Barcode 5010010092007   Scan available.

521. athashriideviibhaagavata praaran'bhyate  Not available; Literature, 1869, Not available, 1598 pages. Barcode 5010010091918   Scan available.

522. athashriigiitaarthabodhinii praaran'bhah  visaajii bhaskara bhaagavata yaan'nen'; Literature, 1873, Ganapatikrishnajii Press , Mumbai, 280 pages. Barcode 5010010091988   Scan available.

523. athashriikaashiimaahaatmyan'praaran'bhate  Not available; Literature, 1869, Not available, 63 pages. Barcode 5010010092019   Scan not available.

524. athashriimadbhagavatakathaashravand-apahuuti praaran'bhah  Not available; Literature, 1896, Not available, 480 pages. Barcode 5010010092039   Scan available.

525. Athashriimadgagavatat'ippand-ii Shriinivaasatiithaiyaa Ekaadashan  Savanur,g.r; Unknown, 1858, G.R. Savanur, Dhrwar, 258 pages. Barcode 5010010010829   Scan not available.

526. Athashriimadgagavatat'ippand-ii Yadupativirachitaa Chatuthai Skadhan  Savanur,g.r; Unknown, 999, Chitrasala Press, Poona, 190 pages. Barcode 5010010010828   Scan not available.

527. Athashriimadgagavatat'ippand-ii Yadupativirachitaa Ekadaso Skadhan  Unknown; Unknown, 999, Unknown, 41 pages. Barcode 5010010010826   Scan not available.

528. Athashriimadgagavatat'ippand-ii Yadupativirachitaa Trutiyo Skadhan  Unknown; Religion. Theology, 999, Unknown, 257 pages. Barcode 5010010010825   Scan not available.

529. Athashriimadgagavatat'ippand-ii Yadupativirachitaapanchamo Skadhan  Unknown; Unknown, 999, Unknown, 122 pages. Barcode 5010010010827   Scan not available.

530. athashriimahedviibhaagavate mahaapuraand-e saptamaskandha praaran'bhyate  shrii krxshhnd-adaasa; Literature, 1886, Sri venkateswara Steam Press , Mumbai, 510 pages. Barcode 5010010092072   Scan available.

531. athashriimahishwanaathadaivajnj-akrxtavrataraajasyanukramand-ikaapraaran'bhah  raavajii shriidhara gon'dhalekara; Literature, 1886, Jagadwichetu Chapkhana , Poone, 578 pages. Barcode 5010010092011   Scan available.

532. athashriimanmahaabhaaratedrond-aparvasha  Not available; Literature, 1914, Not available, 818 pages. Barcode 5010010091951   Scan not available.

533. athashriimanmahaabhaaratesriiparvapraaran'bhah  Not available; Literature, 1876, Not available, 962 pages. Barcode 5010010091999   Scan not available.

534. athashriimanmahaabhaaratevanaparvapraarabhyate  Not available; Literature, 1914, Not available, 616 pages. Barcode 5010010091922   Scan available.

535. Athashriimatryaayaamutodhvitiyan'parichchhaidan  Krishnacharya,t.r; Unknown, 1908, Nirnaya Sagar Press,Mumbai, 447 pages. Barcode 5010010010760   Scan not available.

536. Athashriimatsayapuraand-akramaand-ikaa  krishna Das,k; Unknown, 999, Sri Venkateshwara Steam Press, Mumbai, 639 pages. Barcode 5010010010769   Scan not available.

537. athashriiraamaamrxta gran'tha praaran'bhah  aabaajii raamachan'dra; Literature, 1895, Sri Ramatatwaprakash Chapkhana , Belgaav, 126 pages. Barcode 5010010091987   Scan not available.

538. athashriivedaan'ta padaarthaman'juushhaa arthaatavedaan'tapadaarthakoshah praaran'bhyate  Not available; Literature, 1869, Not available, 347 pages. Barcode 5010010091981   Scan not available.

539. athasmrxtisaaroddhaarapraarambhah  Not available; Literature, 1857, Not available, 380 pages. Barcode 5010010092092   Scan available.

540. athasmrxtisamuchchayaadarshapustakollekhapatrikaa  Not available; Literature, 1872, Not available, 520 pages. Barcode 5010010092095   Scan available.

541. athatattiriiyaman'hitaa praaran'bhah  tukaaraamataatyaa; Literature, 1832, Tatwavivechak Chapkhana , Mumbai, 958 pages. Barcode 5010010091925   Scan not available.

542. athavaachaspartaaya gayaashraadwapaddhati  shrii kaashinii varmaa; Literature, 1896, Not available, 116 pages. Barcode 5010010092015   Scan available.

543. athavaiveda san'hitaa  Panduranga Pandit; Religion, 2000, Krishnadas_Academy_Varanasi, 810 pages. Barcode 5010010004588   Server error, availability unknown.

544. athavaiveda san'hitaa  P Beniram Sarama Gaup; Religion, 1977, DR Bhagawati Prasada Rai, Delhi, 351 pages. Barcode 5010010004589   Server error, availability unknown.

545. athavaiveda san'hitaa pehalaa bhaagan  K.l.joshi; Religion, 2000, Parimal Publications,Delhi, 675 pages. Barcode 5010010000413   Server error, availability unknown.

546. athavaiveda san'hitaa trutigo bhaagan  Shankar Panduranga Pandit; Literature, 1989, Krishnadas_Academy_Varanasi, 856 pages. Barcode 5010010004590   Server error, availability unknown.

547. athavaivedasan'hitaa dusara bhaagan  K.l.joshi; Religion, 2000, Parimal Publications, Delhi, 613 pages. Barcode 5010010000414   Server error, availability unknown.

548. athavaivedasan'hitaa tisaraa bhaagan  K.l.joshi; Religion, 2000, Parimal Publications, Delhi, 727 pages. Barcode 5010010000412   Server error, availability unknown.

549. athavaivediiyaa poppalaada san'hitaa ek kaandaa  Raghu Veera; Religion, 1936, The International Academy Of Indian Culture, Lahore, 171 pages. Barcode 5010010004585   Server error, availability unknown.

550. athavaivediiyaa poppalaada san'hitaa navii kaandaa  Raghu Veera; Religion, 1940, The International Academy Of Indian Culture, Lahore, 122 pages. Barcode 5010010004586   Server error, availability unknown.

551. Athavarvediiya Panj-chapat'aalikaa  Bhagavadatta; Religion. Theology, 1920, Dayaananda Mahaavidyalaya Laahora, 73 pages. Barcode 2030020016055   Scan not available.

552. athavedaantaparibhaashhaapraarabhyate  Not available; Literature, 1869, Not available, 55 pages. Barcode 5010010091986   Scan available.

553. athayogavaasishht'h pan'chamupashamaprakarand-a  Not available; Literature, 1896, Ganapatikrishnajii Press , Mumbai, 1166 pages. Barcode 5010010092008   Scan not available.

554. Atma Praboda  Gulab Chand; Unknown, 1996, Sri Jain Grandha Prakasika, Ahmedabad, 363 pages. Barcode 5010010010836   Scan not available.

555. Atma Purana  Unknown; Unknown, 1996, Unknown, 1037 pages. Barcode 5010010010835   Scan not available.

556. Atma Purana With Hindi Commentary  Somraj Krishna Das; Unknown, 1955, Sri Venkateshwara Steam Press, Mumbai, 1824 pages. Barcode 5010010010834   Scan not available.

557. Atmadarsanam  Dr.v.a.kumaraswamy; Unknown, 1987, Motilal_Banarassidas, 180 pages. Barcode 2020010004255   Scan available.

558. Atmarpanastutih  Sri Sankaranarayana; Unknown, 1982, Krishnadas Academy, 146 pages. Barcode 2020010004258   Scan available.

559. atran' bahu kurviita  Jithendra Bajaj; Art, 1996, Samajneethi Sameekshana Kendram Madras, 298 pages. Barcode 5010010000325   Server error, availability unknown.

560. Atriennial Catalogue Of Manuscripts Vol Ii Part I Sanskrit B  S Kuppuswami Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1917, The Superintendent Government Press, Madras, 388 pages. Barcode 5010010078056   Scan available.

561. Atriennial Catalogue Of Manuscripts Vol Ii Part I Sanskrit C  S Kuppuswami Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1917, The Superintendent Government Press, Madras, 732 pages. Barcode 5010010078121   Scan available.

562. Aumaapatamu  K Vasudeva Sastri; Language. Linguistics. Literature, 1957, Government Oriental Manuscripts Library , Chennai ., 110 pages. Barcode 5010010012655   Scan not available.

563. Aunadikapadarnava  C.kunhan Raja; Unknown, 1939, HINDIPRACHAR PRESS, MADRAS, 280 pages. Barcode 5010010000425   Scan not available.

564. Aund-aadikapadaand-ara~va Grantha 7  Chantaamand-i Ti Raa; Language. Linguistics. Literature, 1939, Pyriiya Vishva Vidhaalaya, 290 pages. Barcode 2030020016025   Scan not available.

565. Aund-aadikapadaara~nd-avah  Chintaamand-ih Ti Raa; Religion. Theology, 1939, Hindii Prachaara~ Presa~, 294 pages. Barcode 2030020016279   Scan not available.

566. Avachchhedakataaniruktti Diidhityaasaha  mahaamahoopaadhyaaya shriigadaadharabhat't'achaarya; Language. Linguistics. Literature, 1901, shriisudarshana muddraaqs-arashaala, 26 pages. Barcode 5010010024400   Scan not available.

567. Avachedakatvanirukti Of Sri Jagadisha Tarkalankara With Lakshmi Commentary  Swami Sri Dharmananda; Literature, 1965, Chaukhamba_samskrit_Samstan, 193 pages. Barcode 5010010000431   Server error, availability unknown.

568. avadaanakalpalataayaa mand-ichuud'aavadaanan' naama trutiiya pallava  Not Available; Philosophy. Psychology, 1908, Haridas Gupta, Benares City, 34 pages. Barcode 5010010026499   Scan not available.

569. Avadanacataka A Century Of Edifying Tales Vol I  Dr. J. S. Speyer; Unknown, 1902, Motilall_Banrsidass_Publishers, 412 pages. Barcode 2020010004264   Scan available.

570. Avantisundarii  aachaarya dand-d'i; Language. Linguistics. Literature, 1954, Suranad Kunjan Pillai , Trivandrum ., 284 pages. Barcode 5010010012654   Scan not available.

571. Avantisundariikathaa  Mahaakavii; Religion. Theology, 1924, Da Diqs-ana~ Presa~, 136 pages. Barcode 2030020016451   Scan not available.

572. avataaravaadaavalin' pradamo bhaagan  Goswami; Religion, 1959, Sri Vadiraraja Prakashana mala Bangalore, 351 pages. Barcode 5010010004626   Server error, availability unknown.

573. Avayava Diidhityaa Diidhitiprakaashikamu  shriigang-geshopaadhyaaya; Language. Linguistics. Literature, 1985, The Central Sanskrit Institute Tirupathi, 142 pages. Barcode 5010010028165   Scan not available.

574. Avimaarak  T Ganapati Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1912, The Travancore Government Press,Trivandrum, 145 pages. Barcode 5010010078697   Scan available.

575. avimaarakan'  tan'. gand-apatishaastrind-aa; Literature, 1913, Rajakeeya Press, 122 pages. Barcode 5010010091926   Scan available.

576. Avmanjari  Acharya Mukunddevagya; Unknown, 1686, RANJAN PUBLICATIONS, 170 pages. Barcode 2020010007804   Scan available.

577. Aya Srimadhnrumatrayam  G.h.bhatt; Literature, 1962, SAKUNTALA,BARODA, 772 pages. Barcode 5010010000434   Scan not available.

578. Ayodhyeche Nabaaba  Paarasaniisa Dattatrayabalavan'ta; Geography. Biography. History, 1899, Baabaajii Sakhaaraama Aand-i kan'panii, 191 pages. Barcode 2030020016377   Scan not available.

579. Ayurved Vigyanasar  Jaikrishndas; Unknown, 1945, CHOUKAMBA SANSKRIT SERIES., 132 pages. Barcode 2020010004281   Scan available.

580. Ayurveda Bhashym Panch Khandm  -; Technology, 1973, -, 864 pages. Barcode 2020050036049   Scan not available.

581. Ayurveda Vijnanam  binod lall sen; Technology, 1916, -, 672 pages. Barcode 2020050036362   Scan not available.

582. Ayurvedabdhisara Part 1  p sri ramachandrudu; Unknown, 1989, sanskrit academy, 674 pages. Barcode 2020010004272   Scan available.

583. Ayurvedhakandah  sri laxmiramaswami mahabhagavanamu; Unknown, 1964, sri giridharasharma chathurvedha, 382 pages. Barcode 2020010004278   Scan available.

Return to the top

B


584. baadhan  Sri Raghunathasiromani; Literature, 1985, Kendriya Sanskrit Vidyapeetha Tirupathi, 77 pages. Barcode 5010010000440   Server error, availability unknown.

585. baala raamaayand-aa  girijaakumaara ghoshha; LANGUAGE. LINGUISTICS. LITERATURE, 1981, hindii pustaka ejensii kalakattaa, 578 pages. Barcode 5010010023450   Server error, availability unknown.

586. Baalabhaaratamu  shriimadamarachandrasuri; Language. Linguistics. Literature, 1894, Tukaram Javaji,Bombay, 515 pages. Barcode 5010010032895   Scan not available.

587. Baalabodha San'graha  shrii machchhang-karaachaarya; Language. Linguistics. Literature, 0, Not available, 26 pages. Barcode 5010010025841   Scan not available.

588. Baalacharitan'  t ganapati sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1912, the travancore goverment press, trivandrum, 82 pages. Barcode 5010010078185   Scan available.

589. baalacharitra  tan'. gand-apatishaastrind-aa; Literature, 1915, Rajakeeya Press, 78 pages. Barcode 5010010091945   Scan available.

590. baalamanorama  Not available; Literature, 1895, Not available, 482 pages. Barcode 5010010092163   Scan available.

591. baalaraamaayanama  shriiraajasekhara; Religion, 1921, , 652 pages. Barcode 5010010087252   Scan not available.

592. Baalaraamaayand-aannama  govindadeva; RELIGION. THEOLOGY, 1869, The Medical Hall Press , Benares, 323 pages. Barcode 5010010042372   Scan not available.

593. baalaraamaayand-am  shrii lakshhmand-asuuri; Literature, 1899, Sri Poornachandrodaya Press, 202 pages. Barcode 5010010091967   Scan available.

594. baalaraamaayand-annaama  shrii govin'dadevashaastrind-aa; Literature, 1869, The Medical Hall Press , Benares, 326 pages. Barcode 5010010091950   Scan available.

595. Baapuu Gokhale Yaan'chen' Charitra  Shaaligraama Shan'karatukaaraama; Geography. Biography. History, 1889, Nira~naya Saagara~ Presa~, 206 pages. Barcode 2030020016295   Scan not available.

596. bagavatgiita  jaacooba; Religion, 1891, Government Central Book Deopt, Bombay, 552 pages. Barcode 5010010087244   Scan not available.

597. Bahudarmaipuraand-amu  Not available; Religion. Theology, 999, Not Available, 590 pages. Barcode 5010010031949   Scan not available.

598. bahuuvuuchasan'dhyaamantraarthadiipikaa  ; Religion, 1921, , 185 pages. Barcode 5010010087188   Scan not available.

599. Baismi Parinaya Champu  Ratna Ketamkavi; Unknown, 1991, Sri_Venkateswara_University, 126 pages. Barcode 2020010004299   Scan available.

600. Baktha Mandram  kalluri ahobila rao; Unknown, 1958, -, 125 pages. Barcode 2020010004304   Scan available.

601. Bakthamala Ramramsikavali  -; Unknown, 999, Gangavishnu_Srikrishna_Das, 1054 pages. Barcode 2020010004303   Scan available.

602. Bala Bharatam  Raramurthi.k.s; The Greatness Of Badari Kshetram Or Holy Place, 1983, The Director, S.V.U.Oriental Research Institute, 327 pages. Barcode 5010010000442   Scan not available.

603. Balabharatham Of Agastya Pandita  K S Ramamurty; Unknown, 1983, The_Director_Sri_Venkateswara_University, 324 pages. Barcode 2020010004308   Scan available.

604. Balaramayana  Dr.ganga Sagar Rai; Unknown, 1984, Chaukhamba Surbharati Prakashan, 432 pages. Barcode 2020010004322   Scan available.

605. Baoudhagamarth Sangraha  Vaidhopahsriparushuramsharma; Unknown, 1956, -, 346 pages. Barcode 2020010004334   Scan available.

606. Beauties From Kalidas  Padhye,k.a; Literature, 1927, K.A.Padhye, 480 pages. Barcode 2020010021789   Scan available.

607. Beejganitham Vol I I I  Sri Durga Prasad Divyvedaen; Unknown, 1941, Naval_Kishore_Yanthralay_Mudritham, 602 pages. Barcode 2020010004359   Scan available.

608. Bhaagavatachampuu  shriiabhinavakaalidaasa; Language. Linguistics. Literature, 1929, gopaal'anaaraayand-a kan'panii mun'bayii, 126 pages. Barcode 5010010024418   Scan not available.

609. Bhaamahiiya Kaavyaalang-kaara Udyaana Vritti  d. t. tataachaarya siroomani; Religion. Theology, 1934, srinivasa press, tiruvaadi, 358 pages. Barcode 5010010025844   Scan not available.

610. Bhaamatii Brahmasuutrabhaashya Katusuutri  vaachaspati; Language. Linguistics. Literature, 1933, theosophical publishing house, madras, 644 pages. Barcode 5010010025845   Scan not available.

611. Bhaamatii Prathamo Bhaaga  Vaachaspathimishraa; Philosophy. Psychology, 1935, Vidhyaa Vilaasa Presa~, 324 pages. Barcode 2030020016445   Scan not available.

612. Bhaamatiisamaaloochanamuu  shrii gn-aanaanandendrasarasvatiisvaamii; Language. Linguistics. Literature, 0, prakaashanasthaanamuu, 144 pages. Barcode 5010010017965   Scan not available.

613. Bhaaminiivilaasa  Pand-ashiikarasan'shodhitaa; Religion. Theology, 1933, Paand-d'urang-ga Jaavajii, 190 pages. Barcode 2030020016071   Scan not available.

614. Bhaaminiivilaasa  kaas'inaatha paanduranga paraba; Language. Linguistics. Literature, 1933, The Nirnaya Sagar Press , Mumbai ., 182 pages. Barcode 5010010012574   Scan not available.

615. Bhaaminivilaasan  shriijagatraaya; Language. Linguistics. Literature, 1894, Tukaram Javaji,Bombay, 156 pages. Barcode 5010010032847   Scan not available.

616. Bhaarata Chaampuu  gaanjan chintaman deo; Language. Linguistics. Literature, 0, ganpat krishnajis press bombay, 206 pages. Barcode 5010010017966   Scan not available.

617. Bhaarata Charitra Pariikqs-aa  vaasishht'a gand-apati; Geography. Biography. History, 1961, G.L. Kantam, Yellamanchili, 348 pages. Barcode 5010010028166   Scan not available.

618. Bhaarata Ko Janagananaa 1981  p.padmanaabha; Language. Linguistics. Literature, 0, sri balamanorama press mylapore madras, 708 pages. Barcode 2020050058043   Scan not available.

619. Bhaarata Ko Janagananaa 1981  p.padmanaabha; Language. Linguistics. Literature, 0, macmillan and co ltd, 1280 pages. Barcode 2020050058045   Scan not available.

620. Bhaarata Ko Janagananaa 1981 Part Iii B  p.padmanaabha; Language. Linguistics. Literature, 0, sri balamanorama press mylapore madras, 902 pages. Barcode 2020050058042   Scan not available.

621. bhaarataanuvarnd-aanam  gand-apati shaastri; Literature, 1905, Printers Jabbing Press , Trivendram, 170 pages. Barcode 5010010092065   Scan available.

622. bhaaratamarjjarii  pan'd'ita durgaaprasaada; Literature, 1898, Nirnayasagar Press , Mumbai, 350 pages. Barcode 5010010091924   Scan available.

623. bhaaratasam'graha  Sri Lakshmana Suri; LANGUAGE. LINGUISTICS. LITERATURE, 1906, V. G. And Brothers, 184 pages. Barcode 5010010032208   Server error, availability unknown.

624. bhaaratiishlokatrishatii  Not available; Literature, 1869, Not available, 150 pages. Barcode 5010010091947   Scan available.

625. Bhaaratiistava Prathaman' Mudrand-ama~  Kapaaliishaastrii Ti Vi; Language. Linguistics. Literature, 1948, Shrii Aravindaashrama Pan'd'icheri, 51 pages. Barcode 2030020015973   Scan not available.

626. Bhaaratiiya Raajaniiti Prakaasha  Dravida Rajesvar Sastri; Social Sciences, 999, P. Vasanth Ananth Gadgil, 82 pages. Barcode 5010010027973   Scan not available.

627. Bhaaratiiya Vana Adhiniyam Miimaan'sa  laqs-mand-a sin'ha khanna; Language. Linguistics. Literature, 0, khanna bandhu, 156 pages. Barcode 5010010012105   Scan not available.

628. bhaaratiiyamu athaishaastramu  Pachamukhi; Literature, 1998, AmarPrinting press, Delhi, 174 pages. Barcode 5010010000483   Server error, availability unknown.

629. Bhaashhyaara~tha Ratnamaalaa Grantha 75  Subrahmand-ya; Religion. Theology, 1915, Aanandaashramamudrand-aalaye, 442 pages. Barcode 2030020016165   Scan not available.

630. Bhaashhyaartharatnamaala  harinaaraayand-a; Language. Linguistics. Literature, 1936, Ananda Sama Mudranalaya, Poona, 430 pages. Barcode 5010010024423   Scan not available.

631. bhaashhyaatheratnamaalaa  Sri Subramanya; Philosophy. Psychology, 1914, Anandha Ashrama Press, 426 pages. Barcode 5010010026498   Scan not available.

632. bhaashhyaayairatnamaalaa  Hari Narayan Apte; Literature, 0, Anada Asramamudranalaya, 432 pages. Barcode 5010010004696   Server error, availability unknown.

633. bhaashhyagaambhiiyothenind-eyamand-d'anaaraye grantha  Venkararaghavan Sastri; Philosophy. Psychology, 1913, Vavilala and Co, 90 pages. Barcode 5010010026497   Scan not available.

634. Bhaaskarodaya  niilakat'ha; LANGUAGE. LINGUISTICS. LITERATURE, 1903, Not Available, 216 pages. Barcode 5010010078264   Scan available.

635. Bhaaskarodayaa Tarkasan'grahadiipikaa Prakaashasya Vyaakhyaa Padavaakyapramaand-apaaraavaariind-a  niilakand-t'habhat't'asuunupand-d'ita; Language. Linguistics. Literature, 1915, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 230 pages. Barcode 5010010026030   Scan not available.

636. Bhaat't'adiipikaa Niviitaanto Bhaaga 1  Shriimadatkhand-d'adeva; Philosophy. Psychology, 1922, Nira~naya Saagara~ Presa~, 401 pages. Barcode 2030020016330   Scan not available.

637. Bhaat't'adiipikaa Part I  anantakushhnd-a; LANGUAGE. LINGUISTICS. LITERATURE, 1921, The Nirnaya Sagr Press , Bomaby, 332 pages. Barcode 5010010042566   Scan not available.

638. Bhaat't'adiipikaa Shriimatkhand-d'adevaprand-iitaa  N.s. Anantha Krishna Sastri; Philosophy. Psychology, 1921, Pandurang Jawaji, 387 pages. Barcode 5010010029964   Scan not available.

639. Bhaat't'adiipikaa Uttarashhat'ahamam  Not Available; Philosophy. Psychology, 999, Not Available, 194 pages. Barcode 5010010030003   Scan not available.

640. Bhaat't'amiimaan'sakaanaan' Sarvasvamu Shabdapramaand-asya Vaishiptyamu  Not available; Language. Linguistics. Literature, 0, Not available, 300 pages. Barcode 5010010024811   Scan not available.

641. Bhaavanaa Viveka  mandana misra; LANGUAGE. LINGUISTICS. LITERATURE, 1922, The Superintendent Of The Government Press,Allahabad, 118 pages. Barcode 5010010078706   Scan available.

642. Bhaavanaaviveka Sat'iika  mand-d'anamishra; Language. Linguistics. Literature, 0, tata printing works, benares, 70 pages. Barcode 5010010026031   Scan not available.

643. Bhaavaprakaasha Bhaavabodhiniihindiivyaakhyaayopeta  Not available; Language. Linguistics. Literature, 0, Not available, 146 pages. Barcode 5010010024424   Scan not available.

644. Bhadranyaka Upanishad  -; Language. Linguistics. Literature, 1951, sri ramakrishna math madras, 560 pages. Barcode 2020050036349   Scan not available.

645. Bhagadattajalhand-a Virachitaa Sukttimukttaavalii  Embar Krishnamacharya; Philosophy. Psychology, 1938, Oriental Institute, Baroda, 624 pages. Barcode 5010010027974   Scan not available.

646. Bhagavadajjukam  Veturi Prabhakara Shastry; Unknown, 1986, MANIMANJARI PUBLICATIONS, 52 pages. Barcode 2020010004378   Scan available.

647. Bhagavadanudhaavananaamaa Champuprabandha  u krxshhnd-ashaastrii; Language. Linguistics. Literature, 1955, Not available, 310 pages. Barcode 5010010012653   Scan not available.

648. Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha  Shaastrii Ananta Krxshhnd-a; Religion. Theology, 1944, Shrii Jayantakrxshhnd-a Dave, 111 pages. Barcode 2030020016075   Scan not available.

649. Bhagavadgiitaa  bhagavaan daasa; Language. Linguistics. Literature, 1926, theosophical publishing house madras, 439 pages. Barcode 5010010017733   Scan not available.

650. Bhagavadgiitaya Luupanyaasagal'u Eran'd'anaya Bhaaga  shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru; Religion. Theology, 1999, Adyatmika Publications, 584 pages. Barcode 5010010017574   Scan not available.

651. Bhagavadgiitaya Luupanyaasagal'u On'danaya Bhaaga  shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru; Religion. Theology, 1999, Adyatmika Publications,Holenarispur, 661 pages. Barcode 5010010017573   Scan not available.

652. Bhagavadgitha Anandatirtha  Unknown; Unknown, 1887, Unknown, 798 pages. Barcode 5010010010833   Scan not available.

653. bhagavadgiyaanasopaanamu  Krishhnd-akumaari; Religion, 2000, Satya publications, Ramantapur, 96 pages. Barcode 5010010004645   Server error, availability unknown.

654. Bhagavadgund-adapand-aakhyamu Shriivishhnd-usahastranaamabhaashhyamu  shriivatsaang-kamishra; Language. Linguistics. Literature, 1964, ratnam press madras, 322 pages. Barcode 5010010028167   Scan not available.

655. Bhagavadraamaanujavijaya Gadhyaprabandha  god'avarti shat'hakopaachaarya; Language. Linguistics. Literature, 1983, Not available, 282 pages. Barcode 5010010026032   Scan not available.

656. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I  Venimadhav Sahastri Musalgonkar; Unknown, 1985, Chaukhamba Sanskrit Pratishthan, 954 pages. Barcode 2020010004382   Scan available.

657. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I I  Venimadhav Sahastri Musalgonkar; Unknown, 1985, Chaukhamba Sanskrit Pratishthan, 340 pages. Barcode 2020010004381   Scan available.

658. Bhagavata Tippani Chalari  Unknown; Unknown, 0, Unknown, 383 pages. Barcode 5010010010832   Scan not available.

659. Bhagavatham With Curmikatika Vijayadwaja Tirtha Padaratnavali 1892  Unknown; General, 999, Unknown, 1335 pages. Barcode 5010010010821   Scan not available.

660. Bhaimiiparind-ayannaama Naat'akamu Nalavijayaaparanaamakamu  mand-d'ikala raamashaastriind-a; Language. Linguistics. Literature, 1914, mahishuurapure raajakiiya shaakha mudraaqs-arashaala, 294 pages. Barcode 5010010026033   Scan not available.

661. bhaipajyaratnaavalii sat'iika  navala kishora; Literature, 1893, Not available, 905 pages. Barcode 5010010092127   Scan available.

662. Bhaishhajyaratnaavalii  shriigovindadaasa; Language. Linguistics. Literature, 1930, motilaala banaarasiidasa, dilli, 1271 pages. Barcode 5010010026035   Scan not available.

663. Bhaismiparinayacampu  S.r. Matha; Art, 1991, S.V.U. Oriental Research Institute Tirupati, 120 pages. Barcode 5010010000461   Scan not available.

664. Bhaktamaalaa Raamarasikaavalii  khemaraaja shriikrxshhnd-adaasa; Language. Linguistics. Literature, 1952, shriiven'kat'eshvara yantraalayama, 1169 pages. Barcode 5010010012652   Scan not available.

665. Bhaktanand Taraang-igrii  pandit vidyanath jha; LANGUAGE. LINGUISTICS. LITERATURE, 1916, Lala Shankar Sahay Taluqsar Umadatta Vajapayee The Brahman Press, Cawnpore, 28 pages. Barcode 5010010078801   Scan available.

666. Bhakti Chan'drikaa  Naaraayand-atiira~tha; Religion. Theology, 1938, Da Suparin'd'ent'a Prin't'inga~ En'd'a St'ashinarii Gavara~namen't'a~ Presa~, 223 pages. Barcode 2030020016396   Scan not available.

667. bhaktimarjjarii  tan'. gand-apatishaastrind-aa; Literature, 1904, Rajakeeya Press, 210 pages. Barcode 5010010092041   Scan available.

668. Bhakttisudhaataran'gand-ii  Not Available; Language. Linguistics. Literature, 0, Not Available, 462 pages. Barcode 5010010012572   Scan not available.

669. Bhamahas Kavyalankara  d.t. tatachary siromani; Language. Linguistics. Literature, 1934, the srinivasa press, 420 pages. Barcode 2020050058047   Scan not available.

670. Bhaminivilasa  Har Dutt Sharma; Unknown, 1935, Orient_Book_Agency, 174 pages. Barcode 2020010004395   Scan available.

671. Bhamti Ekk Adhyayan  Dr. Eeshwar Singh; Unknown, 1983, Manthan_Publications, 172 pages. Barcode 2020010004396   Scan available.

672. Bharadvajasiksa  V.r.ramachandra Dikshitar; Unknown, 1938, Bhandarkar Oriental Research Institute, 112 pages. Barcode 2020010004398   Scan available.

673. Bharata Kaumudi Part I  Dr Radha Kumud Mookherji; Unknown, 1945, THE INDIAN PRESS, 589 pages. Barcode 2020010004402   Scan available.

674. Bharata Natya Darsanam  n gopalapanicker; Unknown, 1981, n gopalapanicker, 442 pages. Barcode 2020010004404   Scan available.

675. Bharatabhasyam Part 1 Chapt 1 5  naanyabhupal; The Arts, 1961, Indira kala sangit vishwavidyalaya khairagarh, 222 pages. Barcode 2020050058014   Scan not available.

676. Bharatamajjari  shriikshemendra; Language. Linguistics. Literature, 1898, Tukaram Javaji,Bombay, 857 pages. Barcode 5010010032879   Scan not available.

677. Bharatarnava Of Nandikeshwar  Vachaspti Gairola; Unknown, 1978, Chaukhamba_Amarabharati_Prakashan, 304 pages. Barcode 2020010004406   Scan available.

678. Bharatarnava Of Nandikeswara  K Vasudeva Sastri; Unknown, 1956, -, 712 pages. Barcode 2020010004407   Scan available.

679. Bharathi Nirukth Vedh Swarup Darshan  Janaswamy Subramanya Shasthri; Unknown, 1974, Niruktha Bharathi, 860 pages. Barcode 2020010004430   Scan available.

680. Bharathiy Darshan Me Parivarthan Ka Swarup Vishestha Boudd Darshan Ke Sandarb Me  Manju; Unknown, 1985, Eastern_Book_Linkers, 240 pages. Barcode 2020010004436   Scan available.

681. Bharatiiya Jyotishha  nemichandra sastri; General, 2005, bharateya gnanapeeth, 450 pages. Barcode 2020050017211   Scan available.

682. Bharatiyam Vrttam  V S Venkata Ragavacharya; Unknown, 1968, KENDRIYA SANSKRIT VIDHYAPEETHA, 306 pages. Barcode 2020010004440   Scan available.

683. Bhartiya Darshan Ka Itihas  M.n.dasgupta; Unknown, 1973, Rajastan_Hindi_Granth_Academy, 510 pages. Barcode 2020010004444   Scan available.

684. Bhartrxharisubhaashhitamu  Not available; Language. Linguistics. Literature, 0, Not available, 71 pages. Barcode 5010010028168   Scan not available.

685. Bhas Kee Bhasa Sambandhee Tat(natakeeya Visheshtaem  Dikshit,jd; Literature, 1936, B.Vijaya Ramaiah, Guntur, 316 pages. Barcode 5010010000492   Scan not available.

686. Bhasa Ki Sambhandi Thatha Natakiya Visheshathaye  Dikshit Jd; Literature, 0, Franz Steiner Verlag Gmbh Wiesbaden, 316 pages. Barcode 5010010004690   Server error, availability unknown.

687. Bhasa Svapnavasavadatta  g k bhatt ed; Language. Linguistics. Literature, 0, the popular book store surat, 260 pages. Barcode 2020050057954   Scan not available.

688. Bhasa's Pratima Part Ii Natakam  Kumudranjan Ray; Literature, 1942, Kay, Calcutta, 0 pages. Barcode 5010010000493   Scan not available.

689. Bhasa's Pratima Part Ii Natakam  Kumudranjan Ray; Literature, 1942, Kay, Calcutta,  pages. Barcode 5010010002506   Scan not available.

690. Bhasas Balcharitam  S R Sehgal; Unknown, 1959, MUNSHI RAM MANOHAR LAL ORIENTAL BOO SELLERS AND PUBLISHERS, 291 pages. Barcode 2020010004447   Scan available.

691. Bhasasastrapravesini  venkata ramana sastri; Philosophy. Psychology, 1938, sri balamanorama press mylapore madras, 252 pages. Barcode 2020050036364   Scan not available.

692. Bhat't'achintaamand-estar^kapaada  Sri Visvesvara Siddi; Philosophy. Psychology, 1957, Sri Babu Haridas Gupta, 178 pages. Barcode 5010010029884   Scan not available.

693. Bhat't'achintaamand-i  venkat'asubrahmand-ya; LANGUAGE. LINGUISTICS. LITERATURE, 1934, The Madras Law Journal Press , Madras, 670 pages. Barcode 5010010042562   Scan not available.

694. Bhat't'akalpataru  Sri Rama Subramanya Sastri; Philosophy. Psychology, 1915, Nivitanta, 120 pages. Barcode 5010010029904   Scan not available.

695. bhat't'ikaavyam  shriijiivaanandavidyaasaagara bhat'at'aachaarye; Literature, 1866, Kalakatta Printing Press , Kalakatta, 634 pages. Barcode 5010010092032   Scan available.

696. bhat't'ikaavyama prathama sarga  vi.ji. pradhaana; Literature, 1897, Ambaprasad Chapkhane , Poone, 179 pages. Barcode 5010010091954   Scan not available.

697. Bhat't'ikaavyamu  jayamangalayaa; Language. Linguistics. Literature, 1900, Tukaram Javaji,Bombay, 580 pages. Barcode 5010010032908   Scan not available.

698. Bhat't'ikaavyamu Chandrakalaa Vidyotinii San'skrxta Hindii Vyaakhyaadvayopetamu Dvaadashaadi Dvaabin'shatisarmaparyantamu  shriimadbhat't'i; Language. Linguistics. Literature, 1952, chaukhambaa san'skrxta pustakaalaya banaarasa, 424 pages. Barcode 5010010024429   Scan not available.

699. Bhat't'ikaavyamuu  mahaakavishriibhat't'i; Religion. Theology, 1914, nirnd-ayasaagara mudrand-ayantraalayamu mun'bayyaa, 511 pages. Barcode 5010010017967   Scan not available.

700. Bhatruhari S Neetisataka  Swetaranyam Narayana Sastriar; Unknown, 1951, V_Ramaswamy_Sastrulu_And_Sons, 165 pages. Barcode 2020010004452   Scan available.

701. Bhatta Bhasha Prakash  -; Language. Linguistics. Literature, 1947, -, 74 pages. Barcode 2020050036368   Scan not available.

702. Bhatta Chintamani Tarkapada  S.surya Narayana; Vacant, 1933, The Chowkhamba Sanskrit Series Office Varanasi, 297 pages. Barcode 5010010000499   Server error, availability unknown.

703. bhatta dipika  khanda deva; Religion, 1899, Baptist Mission Press, Calcutta, 387 pages. Barcode 5010010087214   Scan not available.

704. Bhatta Dipika Uttarasatka Part I I  Panditraja A Subramanya Sastri; Unknown, 1952, University_Of_Madras, 552 pages. Barcode 2020010004453   Scan available.

705. Bhatta Dipika(uttrasatka Part I) With The Prabhavali Of Sambhu Bhatta  S Subramnya Sastri; Unknown, 1952, University_Of_Madras, 519 pages. Barcode 2020010004454   Scan available.

706. Bhattalankara Tikayuta  Ananta Deva; Unknown, 1921, CHOWKHAMBA SANSKRIT SERIES, 512 pages. Barcode 2020010010903   Server error, availability unknown.

707. Bhattaldankartikaythu  Sri Laxmana Sastry; Unknown, 1921, Chowkhamba_Sanskrith_Series_Office, 518 pages. Barcode 2020010004455   Scan available.

708. Bhatti Kavyam Canto 10  Saradaranjan Ray; Unknown, 1959, Kumudranjan_Ray, 252 pages. Barcode 2020010004456   Scan available.

709. Bhatti Kavyam Canto 11 12  Saradaranjan Ray Vidya Vinoda; Unknown, 1909, Kumudranjan_Ray, 280 pages. Barcode 2020010004457   Scan available.

710. Bhattikasudhaatarad'igand-i  t k balasubrahmanyam; RELIGION. THEOLOGY, 1913, sri vani vilas press, srirangam, 606 pages. Barcode 5010010078786   Scan available.

711. Bhattikavya Of Bhatti  Late Vinayak Narayan Shastri Vasudev Laxman Shastri; Unknown, 1934, PANDURANG JAWAJI, 504 pages. Barcode 2020010004459   Scan available.

712. Bhava Prakasika  sri ranga ramanujamuni; Unknown, 1959, T.T.D Tirupati, 984 pages. Barcode 2020010004464   Scan available.

713. bhavabhuuti  tukaaraama jaavaajii; Literature, 1892, Nirnayasagar Press , Mumbai, 400 pages. Barcode 5010010092118   Scan available.

714. Bhavana Viveka  Mandana Misra; Philosophy. Psychology, 1922, Govt. Of Allahabad, 138 pages. Barcode 5010010029886   Scan not available.

715. Bhavaprakasa Of Bhavamisra  pandit sri bhramha shankara misra; Unknown, 1949, jayakrishnadas haridas gupta, 580 pages. Barcode 2020010004463   Scan available.

716. Bhavprakashnidhantu  Balvanth Singh; Unknown, 999, CHOWKHAMBA SASNKRITH SERIES OFFICE, 540 pages. Barcode 2020010004465   Scan available.

717. Bhavya Bharatham  C Lakshmi Kantaiah; Unknown, 1974, -, 60 pages. Barcode 2020010004466   Scan available.

718. Bheda Ratnam  Gopinath Kaviraja; Vacant, 1933, Government Oriental Manuscripts Library Madras, 134 pages. Barcode 5010010000503   Server error, availability unknown.

719. Bheda Vidya Vilasa  R Nagaraja Sarma; Unknown, 1945, Sri_Parimala_Publishing_House, 185 pages. Barcode 2020010004467   Scan available.

720. Bhedadhikkaara Upakaaramapaarkarma Vyaakhyaayasahitamu  shriimannrxsin'gaashramamuni; Language. Linguistics. Literature, 1904, chaukhamba sanskrit series office, benares, 188 pages. Barcode 5010010024431   Scan not available.

721. bhedajayaqs-i  Sri Tarkavagisa Bhatta Venidattacharya; Philosophy. Psychology, 1933, The Princess Of Wales Saraswathi Bhavana Texts, 84 pages. Barcode 5010010026496   Scan not available.

722. Bhedasaamraajyamu  shrii koliyaalamu svaamina:; Language. Linguistics. Literature, 1912, No, 128 pages. Barcode 5010010011748   Scan not available.

723. bhedasaamrajyamuu vedaantabhaaga  Sri Ranga Ramanuja Desikan; Philosophy. Psychology, 1942, Not Available, 130 pages. Barcode 5010010026495   Scan not available.

724. Bheddo Jevana Of Sri Vyasaraja  Tirumala Charya; Vacant, 1991, Vidyapayonidhi prakasana, Bangalore, 135 pages. Barcode 5010010000504   Server error, availability unknown.

725. Bhedojjeevanam  Sri Vyasaraja Tirtha; Dwaita Philosophy, 0, G.R.Savanur, 301 pages. Barcode 5010010000505   Server error, availability unknown.

726. Bhedojjiivana  Not available; Religion. Theology, 0, Not available, 96 pages. Barcode 5010010024432   Scan not available.

727. Bhedojjivana Of Sri Vyasaraja  Prahladacharya; Philosophy, 0, Vidyapayonidhi_Prakashana_Bangalore, 134 pages. Barcode 5010010004700   Server error, availability unknown.

728. Bhelsanhita  Sri Girijadayalu Shukla; Unknown, 1959, Chowkhamba_Vidhya_Bhavan, 320 pages. Barcode 2020010004469   Scan available.

729. Bhesajya Rathna Vathni  Sri Govind Das; Unknown, 999, Motilal_Banarassidas, 640 pages. Barcode 2020010004470   Scan available.

730. Bhiimaparaakraman  shaataanandasunu; Language. Linguistics. Literature, 1954, University Of Travancore , Trivandrum ., 66 pages. Barcode 5010010012571   Scan not available.

731. Bhoja Prabanda Of Ballala  Vasudeva Sharman; Unknown, 1962, Panduranga_Jawaji, 90 pages. Barcode 2020010004474   Scan available.

732. Bhoja s Samaarangana Suutradhaara Vol I  Bhoja; Language. Linguistics. Literature, 1998, New Bharatiya Book Corporation Delhi, 434 pages. Barcode 2020050043598   Scan not available.

733. Bhonsle Vamsa Charitra  gopalan s tr; Geography. Biography. History, 1951, vetrivel press tanjore, 236 pages. Barcode 2020050036091   Scan not available.

734. Bhoojanakutuuhalamuu  raghunaatha; Language. Linguistics. Literature, 1956, Suranad Kunjan Pillai , Trivandrum ., 357 pages. Barcode 5010010012100   Scan not available.

735. Bhoojaprabandha  shriiballaala; Language. Linguistics. Literature, 1918, nirnayasagar press, bombay, 90 pages. Barcode 5010010025664   Scan not available.

736. Bhramara Sandesa  Y Mahalinga Sastri; Unknown, 1954, Sahitya_Chandrasala, 50 pages. Barcode 2020010004481   Scan available.

737. Bhramasuutrabhaashya Bhaaga 1  shrii madhvaachaarya; Language. Linguistics. Literature, 1984, oriental research institute mysore, 444 pages. Barcode 5010010017969   Scan not available.

738. Bhramasuutrabhaashya Bhaaga 1  shrii madhvaachaarya; Language. Linguistics. Literature, 1984, oriental research institute mysore, 441 pages. Barcode 5010010017734   Scan not available.

739. Bhucvaneishalaukikanyaayasaahastrii  t'haakuur; Language. Linguistics. Literature, 1908, Sri Vigneishvar Team Mudranalaya, Bombay, 344 pages. Barcode 5010010028312   Scan not available.

740. Bhuddhabhuushhana  hech.d'i alan'kaar; Language. Linguistics. Literature, 1923, Bhabdarkar Oriental Research Instirute Poona, 126 pages. Barcode 5010010024436   Scan not available.

741. Bhuhajjaatakamu  vi.subramanyasaastri; Language. Linguistics. Literature, 1929, Government Branch Press,Mysore, 650 pages. Barcode 5010010024437   Scan not available.

742. Bhuhgoghatharangani  Narayana; Geography, 1991, Purana Vijnana Mandire, Bangalore., 557 pages. Barcode 5010010006755   Scan not available.

743. Bhupala Mandanam Of Devasri Narada  V. Venkataramana Reddy; Geography, 2003, S.V.U. Oriental Research Institute Tirupati, 122 pages. Barcode 5010010000511   Server error, availability unknown.

744. Bhushanam  Dr Sureshchandra Mishra; Unknown, 1999, RANAJAN PUBLICATIONS, 306 pages. Barcode 2020010005413   Scan available.

745. Bhushanasara Samiksha Part Ii  Ramakrishnamacharya K. V; Literature, 1995, K. S. Lakshmi Tirupati, 212 pages. Barcode 5010010004705   Server error, availability unknown.

746. Bhuukailaasanaat'akamu  gokarnd-a saan'badiiqs-ita; Language. Linguistics. Literature, 1977, shriikrxnd-a mudrand-aalaya hegad'e, 106 pages. Barcode 5010010028303   Scan not available.

747. Bhuvanadiipaka  pandit kashiram; General, 2005, gangavishnu sri krishnadas kalyan prakasan, 88 pages. Barcode 2020050017228   Scan available.

748. Bibliotheca Buddhica V  -; Unknown, 1903, Motilal banarasidas publishers pvt ltd, 220 pages. Barcode 2020010004495   Server error, availability unknown.

749. Bibliotheca Buddhica Vol Vi  -; Unknown, 1992, Mitiolal Banarsidas publishers pvt ltd, 220 pages. Barcode 2020010004493   Scan available.

750. Bibliotheca Buddhica Vol Vii Nyayabindu  -; Unknown, 1918, Mitiolal Banarsidas publishers pvt ltd, 108 pages. Barcode 2020010004492   Scan available.

751. Bibliotheca Buddhica Vol Vvxx  -; Unknown, 1992, Mitiolal Banarsidas publishers pvt ltd, 120 pages. Barcode 2020010004494   Scan available.

752. bibliotheca indica  sankara acharya; Religion, 1860, Baptist Mission Press, Calcutta, 658 pages. Barcode 5010010087211   Scan not available.

753. Bibliotheca Indica A Collection Of Oriental Works  Kavikarnapura; Unknown, 1854, J THOMAS THE BAPTIST MISSION PRESS, 294 pages. Barcode 2020010004496   Scan available.

754. Bibliotheca Indica Volume 27  Vijnanabhikshu; Geography, 1980, Biblio_Verlag_Osnabruck, 362 pages. Barcode 5010010000515   Server error, availability unknown.

755. Bibliotheca Indica Volume 3  E.rose; Literature, 1980, Biblio_Verlag_Osnabruck, 646 pages. Barcode 5010010004708   Server error, availability unknown.

756. Bibliotheca Indica Volume 31 1  M.rajendralala; Literature, 1981, Biblio_Verlag_Osnabruck, 636 pages. Barcode 5010010004707   Server error, availability unknown.

757. Bibliotheca Indica Volume 4  M.rajendralala; Geography, 1980, Biblio_Verlag_Osnabruck, 422 pages. Barcode 5010010000517   Server error, availability unknown.

758. Bibliotheca Indica Volume 45 1  Maheshchandra; Geography, 1983, Biblio_Verlag_Osnabruck, 830 pages. Barcode 5010010000516   Server error, availability unknown.

759. Bibliotheca Indica Volume 71 1  M.rajendralal; Geography, 1987, Biblio_Verlag_Osnabruck, 968 pages. Barcode 5010010000520   Server error, availability unknown.

760. Bibliotheca Indica Volume 71 2  E.rose; Literature, 1987, Biblio_Verlag_Osnabruck, 576 pages. Barcode 5010010004709   Server error, availability unknown.

761. Bibliotheca Indica Volume 71 4  M.rajendralal; Geography, 1987, Biblio_Verlag_Osnabruck, 580 pages. Barcode 5010010000521   Server error, availability unknown.

762. Bibliotheca Indica Volume 71 5  M.rajendralal; Geography, 1987, Biblio_Verlag_Osnabruck, 722 pages. Barcode 5010010000522   Server error, availability unknown.

763. bibliotheca indica1  pingala achaarya; Religion, 1921, , 258 pages. Barcode 5010010087213   Scan not available.

764. bibliotheca indica3  ; Religion, 1866, The Baptist Mission Press, Calcutta, 442 pages. Barcode 5010010087197   Scan not available.

765. Biblotheca Indica  Vijnana Bhikshu; Geography, 1856, BAPTIST MISSION PRESS,CULCUTTA, 66 pages. Barcode 5010010000513   Server error, availability unknown.

766. biblotheka ind'ica  Not available; Literature, 1861, Baptist Mission Press , Calcutta, 468 pages. Barcode 5010010092087   Scan available.

767. biijagand-itam  Not available; Mathematics, 1876, Not available, 164 pages. Barcode 5010010092151   Scan available.

768. Bijn'panaya  baskaraachaarya; LANGUAGE. LINGUISTICS. LITERATURE, 1926, Moti Lal Banarsi Dass , Lahore, 42 pages. Barcode 5010010042559   Scan not available.

769. boddhi san'skruta grandaavalii 21  Vaidya.p.l; , 1959, P.L Vaidya, Pune, 324 pages. Barcode 5010010006773   Scan not available.

770. Bodhaayaniiyagrxhyasuutra  Not available; Language. Linguistics. Literature, 0, Not available, 494 pages. Barcode 5010010025665   Scan not available.

771. Bodhaikyasiddhi Prathamo Bhaaga  Achyutaraaya; Philosophy. Psychology, 1951, Aanandaashramamudrand-aalayan', 388 pages. Barcode 2030020016342   Scan not available.

772. bodhasaaran'  shriividvadvayeinarahari; LANGUAGE. LINGUISTICS. LITERATURE, 1905, Vidya Vilas press, Benaras, 952 pages. Barcode 5010010080120   Scan not available.

773. Bodhasara a treaties on Vedanta  Sri Narahari with a Commentary by the Author's Pupil Pandit Divakar; Geography, 1906, Vidya Vilas Press Benaras, 486 pages. Barcode 5010010006757   Scan not available.

774. Bodhayana Grihya Sutram  L.srinivasacharya; Religion. Theology, 1904, The Government Branch Press Mysore, 505 pages. Barcode 5010010000524   Server error, availability unknown.

775. Bodhicaryavatara  I.tekct; Unknown, 1992, Motilal Banarsidass Publishers, 200 pages. Barcode 2020010004512   Scan available.

776. Bodhicharya Vatara Of Santideva  P L Vaidya; Unknown, 1960, The_Mithila_Insitute, 334 pages. Barcode 2020010004513   Scan available.

777. Boodhaayanaguhaya Suutramu  aar. shaama shaastri; Language. Linguistics. Literature, 1920, The Government Branch Press, Mysore, 524 pages. Barcode 5010010024442   Scan not available.

778. Book Of Exercises Part I  R Antoine; Physical Fitness, 1953, CATHOLIC PRESS, 88 pages. Barcode 2020010004522   Scan available.

779. brahaamanhikamuu  Sri Vasudeva Brahmendra Sarasvati Swamigal; Philosophy. Psychology, 1932, Kozhukuthi S. Natesa Ayyar, Madhura, 73 pages. Barcode 5010010026494   Scan not available.

780. brahaasureabhaashhyamu  R.s.panchamukhi; Religion, 1955, NARAYANATANTRI ,UDIPI, 649 pages. Barcode 5010010006764   Scan not available.

781. brahaasutrabhaashhyamu  Bhaskaracharya; Brahmasutras, 1991, Chowkamba press Varanasi, 269 pages. Barcode 5010010000537   Server error, availability unknown.

782. Brahaasutrashaakarabhaashhyamu Bhaamatiikalpataruparimalopetamu  Sri Sankara Bhagavatpadacharya; Religion. Theology, 0, Sri Vani Vilas Press Srirangam, 355 pages. Barcode 5010010012710   Scan not available.

783. Brahaasutrashaan'karabhaashhyamu Dusaraa Bhaagan  Sri Sankara Bhagavatpadacharya; Language. Linguistics. Literature, 0, Sri Vani Vilas Press , Srirangam ., 354 pages. Barcode 5010010012651   Scan not available.

784. brahaasuutrabhashhyamuu  Sri Gnana Bikshu; Philosophy. Psychology, 1901, Sri Babu Haridas Gupta, 646 pages. Barcode 5010010026493   Scan not available.

785. brahaasuutrabhashhyamuu Text with Tippanis  Wasudev Laxman Shastri Pansikar; Philosophy. Psychology, 1927, Pandurang Jawaji, 534 pages. Barcode 5010010026492   Scan not available.

786. brahaasuutrashaan'karabhaashhyamuu Part Iii With 5 Commentaries  Sri Anantha Krishna Sastri; Philosophy. Psychology, 1941, The MetroPolitan Printing and Publishing press, Calcutta, 994 pages. Barcode 5010010026491   Scan not available.

787. brahaasuutrashaan'karabhaashhyamuu Part Iii With 9 Commentaries  Sri Anantha Krishna Sastri; Philosophy. Psychology, 1933, The MetroPolitan Printing and Publishing press, Calcutta, 708 pages. Barcode 5010010026490   Scan not available.

788. brahaasuutrashaan'karabhaashhyamuu Vol I Chatussutri  Sri Subramanya Sastri; Philosophy. Psychology, 0, Sri Vani Vilas Press and Publishing, Srirangam, 452 pages. Barcode 5010010026489   Scan not available.

789. brahaasuutrashaan'karabhaashhyamuu With Commentaries of Shri Givindananda Vachaspati Anandagiri  Mahadeva Sastri Bakre; Philosophy. Psychology, 1934, Pandurang Jawaji, Bombay, 938 pages. Barcode 5010010026488   Scan not available.

790. brahadhogatarad'ugind-i asyaan' dhvitiyo bhaagan  Narayana; Geography, 1989, Akhila Bharata Madhva Maha Mandali, Madras, 557 pages. Barcode 5010010000510   Server error, availability unknown.

791. Brahama Sphuta Siddhanta Vol Iii  Ram Swarup Sharma; Unknown, 1966, Indinan_Instituete_Of_Astronomical_And_Sanskrit_Researdh, 584 pages. Barcode 2020010004524   Scan available.

792. brahamiimaan'saabhaashhyamuu  Sri Nimbakacharya; Philosophy. Psychology, 1937, Babu Sri hariKrishna Dass Gupta, 100 pages. Barcode 5010010026487   Scan not available.

793. brahamiman'shatrishati  Rangaswami; Philosophy. Psychology, 1949, Sri Venkateswara Publications, 80 pages. Barcode 5010010026486   Scan not available.

794. Brahaspatismrti  K V Rangaswami Aiyangar; Unknown, 1941, Oriental_Institute, 750 pages. Barcode 2020010004526   Scan available.

795. brahasuutraanugund-yashiddhi  Krishnasastri; Philosophy. Psychology, 1923, Sri Gopal Vilas Press, 340 pages. Barcode 5010010026485   Scan not available.

796. Brahatkatha Manjari  Pandurangatmaj Kashinath Sharma; Unknown, 1982, PANINI, 661 pages. Barcode 2020010004527   Scan available.

797. Brahatstotraratnavali Vol I  Khemraj Sri Krishnadass; Unknown, 1878, Sri Venkateshwar Steem Press, 222 pages. Barcode 2020010004528   Scan available.

798. Brahdaranyakopanishath Vol-liv  Shankar Shastry Venegavakar; Unknown, 1832, Ananda _Shrammudranalaya, 336 pages. Barcode 2020010010943   Server error, availability unknown.

799. Brahma Sphuta Siddantha Vol I  Dr.sampurnananad; Unknown, 1966, Indian Institute Of Astronomical And Sanskrit Research, 740 pages. Barcode 2020010004534   Scan available.

800. Brahma Sphuta Siddhanta Vol 3  Acharyavara Ram Swarup Sharma; Unknown, 999, Indian_Institute_Of_Astronomical_And_Sanskrit_Research, 600 pages. Barcode 2020010004536   Scan available.

801. Brahma Sphuta Siddhanta Vol 4  shri bramha gupta; Unknown, 1966, indian insitute of astronomical and sanskrit research, 586 pages. Barcode 2020010004537   Scan available.

802. Brahma Sphuta Siddhanta Vol Ii  Ram Swapup Sharma; Unknown, 1966, Indian_Institute_Of_Satronomical_And_Sanskrit_Resurech, 584 pages. Barcode 2020010004538   Scan available.

803. Brahma Sphuta Siddhanta Vol.2  Archaryavara Rama Swarup Sharma; Unknown, 999, Indian_Institute_Of_Astronomical_And_Sanskrit_Research, 586 pages. Barcode 2020010004535   Scan available.

804. Brahma Sutra Dwithiya Bagamu  Brahmachary Vishnu; Unknown, 1979, Vedhanth_Kesari_Karyalay, 779 pages. Barcode 2020010004543   Scan available.

805. Brahma Sutra Nyaya Sangraha  Sri Vijayeendra Tirtha; Religion, 1944, Sri_Parimala_Publishing_House,Nanjanagud, 18 pages. Barcode 5010010000549   Server error, availability unknown.

806. Brahma Sutra Sariraka Bhaaga 1  sri bhagavad ramaanuja; Language. Linguistics. Literature, 1963, shriivathsa press madras, 453 pages. Barcode 5010010018026   Scan not available.

807. Brahma Suutraand-i  hari naaraayand-a; Language. Linguistics. Literature, 1933, Ananda Sama Mudranalaya, Poona, 461 pages. Barcode 5010010024447   Scan not available.

808. Brahma Suutraand-i Grantha 67  Not Available; Religion. Theology, 1911, Not Available, 462 pages. Barcode 2030020016015   Scan not available.

809. Brahma Vaivarth Eak Pradyayan  sathyanarayan tripati; Unknown, 1681, smruthi prakaran, 402 pages. Barcode 2020010004547   Scan available.

810. Brahma Vaivartha Puranamu Vol 1  Sri Madra Dwapayamuni; Unknown, 1965, Anandasram_Mudranalay, 452 pages. Barcode 2020010004546   Scan available.

811. Brahmaand-d'apuraand-ettarabhaagiiyan' Lalitaasahasranaama Saubhaagyabhaaskaraaravyabhaashhyan  bhaaskararaaya; Language. Linguistics. Literature, 1927, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 266 pages. Barcode 5010010025669   Scan not available.

812. brahmaasuutraand-i  Hari Narayana Apte; PHILOSOPHY. PSYCHOLOGY, 1922, Anandha Ashrama Press, 753 pages. Barcode 5010010021653   Server error, availability unknown.

813. brahmaasuutraand-i  Hari Narayana Apte; Philosophy. Psychology, 1922, Anandha Ashrama Press, 604 pages. Barcode 5010010026484   Scan not available.

814. Brahmamiimaan'saabhaashhyamu  shriinimbaarkaachaarya; Religion. Theology, 1967, vaarand-asyaamu vidhyaavilaasayantraalaya, 102 pages. Barcode 5010010025670   Scan not available.

815. Brahmanda Purana Of Sage Krsna Dvaipayana Vyasa  J L Shastri; Unknown, 1973, Motilal_Banarsidas, 326 pages. Barcode 2020010004529   Scan available.

816. Brahmanda Puranam  Somraj Krishna Das; Unknown, 999, Sri Venkateshwara Steam Press, Mumbai, 708 pages. Barcode 5010010010820   Scan not available.

817. Brahmanjali Nam Parameswararpitha Slokamalika  Arka Somayaji; Unknown, 1959, Arka_Somayaji, 168 pages. Barcode 2020010004530   Scan available.

818. Brahmasiddhi  Acharya Mandanmisra; Unknown, 1937, The_Superintendent_Government_Press, 644 pages. Barcode 2020010004532   Scan available.

819. brahmasiddhi Of mand-namishra Vol 1 brahmakaandaa  Prof. S. Kuppuswami Sastri; Philosophy. Psychology, 1937, Government Press, Madras, 191 pages. Barcode 5010010026483   Scan not available.

820. Brahmasutra Bhashya  R.s.panchamukhi; Philosophy, 1980, Raghavendra Teertha Prathistana Dharwad, 758 pages. Barcode 5010010004725   Server error, availability unknown.

821. Brahmasutra Bhashya Of Sri Madhvachrya,tatvaprakashka1,2  R.s.panchamukhi; Brahmasutras, 1980, Sri_Raghavendra_Tirtha_Pratishtanam, 448 pages. Barcode 5010010000535   Server error, availability unknown.

822. Brahmasutra Bhasyamsahithayatham Thathvaprakasika  Unknown; Language. Linguistics. Literature, 999, Unknown, 372 pages. Barcode 5010010010700   Scan not available.

823. Brahmasutra Bhasyamsahithayatham Thathvaprakasika  Unknown; General, 0, Unknown, 762 pages. Barcode 5010010010819   Scan not available.

824. brahmasutraa nimbaakaibhaashhyamu  Madanmohan Agarwal; Brahmasutras, 2000, Chaukhamba Sanskrit Pratishthan, Delhi, 596 pages. Barcode 5010010000538   Server error, availability unknown.

825. brahmasutraa nimbaakaibhaashhyamu  V. Venkataramana Reddy; Brahmasutras, 2003, S.V.U. Oriental Research Institute Tirupati, 185 pages. Barcode 5010010000541   Scan not available.

826. brahmasutraa nimbaakaibhaashhyamu charma bhagan  Madanmohan Agarwal; Brahmasutras, 2000, Chaukhamba Sanskrit Pratishthan, Delhi, 416 pages. Barcode 5010010000539   Server error, availability unknown.

827. brahmasutraa nimbaakaibhaashhyamu panchamo bhagan  Yogeswara Dutta Sharma; Brahmasutras, 2002, Nag Publishers,Delhi, 510 pages. Barcode 5010010000540   Server error, availability unknown.

828. brahmasutraavabhavamu  V.prabanjanacharya; Brahmasutras, 1991, S.M.S.O.Sabha PUblications, 203 pages. Barcode 5010010000542   Server error, availability unknown.

829. brahmasutraavabhavamu vrittimit'aksaraa  T. Chandrasekharan; Philosophy, 1991, S.M.S.O.Sabha PUblications, 290 pages. Barcode 5010010004729   Server error, availability unknown.

830. Brahmasutrabhashya  Laxman Shastri Pansikar; Unknown, 1915, Tukaram_Javaji, 536 pages. Barcode 2020010004541   Scan available.

831. Brahmasutrabhasya Of Sri Madhvacharya Vol 1  Not available; Language. Linguistics. Literature, 1984, oriental research institute, mysoore, 441 pages. Barcode 5010010017735   Scan not available.

832. Brahmasutrabhasya Vol 1  Pandit V.ananthacharya; Unknown, 1937, Pandit_A.r.krishnamachariar, 95 pages. Barcode 2020010004542   Scan available.

833. Brahmasutradipka  Sankaranda Sri; LANGUAGE. LINGUISTICS. LITERATURE, 1904, Braj B. Das and Co Benares, 103 pages. Barcode 2020050088358   Scan available.

834. Brahmasutras And Dasasloki  G.s.nene; Unknown, 1927, CHOWKHAMBA SANSKRIT SERIES OFFICE, BENNARAS, 329 pages. Barcode 5010010001950   Scan not available.

835. Brahmasutrashaariirabhashhyaara~tha Bhaaga Tiisara  Bhaapat'ashastrii Vishhnd-uvaamana; Natural Sciences, 1925, Shrii Vishhnd-u Shaastrii Baapat'a, 890 pages. Barcode 2030020016360   Scan not available.

836. Brahmasutravrtti Mitaksara Of Annambhatta  P.s.rama Sastri; Unknown, 1950, Government_Oriental_Manuscripts_Library, 286 pages. Barcode 2020010004544   Scan available.

837. Brahmasuutrabhaashhyaalochanasya Prathama Chatu Suutrii  vidhyaabhaaskara shriimand-ishang-karo vasantaraamaatmaja upaadhyaaya; Language. Linguistics. Literature, 0, Not available, 246 pages. Barcode 5010010024445   Scan not available.

838. Brahmasuutrabhaashhyamu Prathamo Bhaaga  Not available; Language. Linguistics. Literature, 0, sri vani vilasa press, srirangam, 340 pages. Barcode 5010010025671   Scan not available.

839. Brahmasuutrabhaashhyamuu Samalang-krxtamu  shriimajjayatiirtha vyaasatiirtha; Language. Linguistics. Literature, 1984, praachyaviddyasan'shoodhanaalayamu maisuuru, 441 pages. Barcode 5010010017968   Scan not available.

840. brahmasuutram  shrii devaachaarya; Literature, 1896, Vidyavilas Chapkhana , Benares, 596 pages. Barcode 5010010092023   Scan available.

841. Brahmasuutrashaan'karabhaashhyamuu  Not available; Language. Linguistics. Literature, 0, Not available, 322 pages. Barcode 5010010018025   Scan not available.

842. Brahmasuutrashaang-karabhaashhyamu Sat'ippanan' Muulakaatramu  vaasudevasharma; Religion. Theology, 1915, nirnd-ayasaagara ravyamudrand-aalayamu mumbayyaan', 530 pages. Barcode 5010010024446   Scan not available.

843. brahmasuutrashang-karabhaashhyamu ratnaprabha dvitiiyo bhaaga  shriimachchhang-karaachaarya; RELIGION. THEOLOGY, 1977, chaukhambhaa san'skrxta san'sthaana, vaaraand-asii, 753 pages. Barcode 5010010023356   Server error, availability unknown.

844. Brahmatatvaprakashika  t'i gand-apati saastri; Language. Linguistics. Literature, 1909, Travancore Government Press, Trivandrum, 200 pages. Barcode 5010010025173   Scan not available.

845. Brahmavaivara~tapuraand-ama~ Prathamo Bhaaga Grantha 102  Maraat'he Vaasudeva Shaastrii; Religion. Theology, 1935, Aanandaashramamudrand-aalaye, 457 pages. Barcode 2030020016088   Scan not available.

846. Brahmavaivara~tapurand-ama~ Dditiiyo Bhaaga Grantha 102  Aapat'e Vinaayaka Gand-esha; Religion. Theology, 1935, Aanandaashramamudrand-aalaye, 503 pages. Barcode 2030020016037   Scan not available.

847. Brahmavaivarta Maha Puranam  Somraj Krishna Das; Unknown, 1867, Sri Venkateshwara Steam Press, Mumbai, 463 pages. Barcode 5010010010817   Scan not available.

848. Brahmavaivarta Puranam  Unknown; Unknown, 999, Unknown, 260 pages. Barcode 5010010010818   Scan not available.

849. Brahmavaivatar Puraand-ama~  Gand-esha Vinaayaka; Religion. Theology, 1935, Aanandaa Shramamudrand-aalaye, 457 pages. Barcode 2030020016060   Scan not available.

850. Brahmavaivatara~purand-ama~ Ddvitiiyo Bhaaga Grantha 102  Aapat'e Vinayaka Gand-esha; Religion. Theology, 1935, Aanandaashramamudrand-aalaye, 503 pages. Barcode 2030020016050   Scan not available.

851. Brahmavidaashiirvaada  shriividhyaarand-ya; Religion. Theology, 1981, vidhyaarandya vidyaapiitha trust, hampi, 30 pages. Barcode 5010010025672   Scan not available.

852. brahmavidyaabharand-am  hariharashaastriind-aa; Literature, 1876, Not available, 832 pages. Barcode 5010010092114   Scan available.

853. brahmsuutrashaan'karabhaapyam  Not available; Literature, 1896, Not available, 566 pages. Barcode 5010010091997   Scan not available.

854. Brahnni Ghantu Ratnakar Vol V I  Sri Krishna Das Satmaj Gangavishnu; Unknown, 999, Laxmi_Venkateshwar_Mudranaly, 600 pages. Barcode 2020010004551   Scan available.

855. Brahnnighantu Ratnakar Vol I  Sri Krishnadas Aatmajain Ganga Vishnuna; Unknown, 999, Lakshmi_Venkateswar_Mudranalay, 396 pages. Barcode 2020010004550   Scan available.

856. Braj Bakthi Vilas  Srilnarayana Bhatta Goswami; Unknown, 999, Met_Sriramrikdasji_Parasarampuriya, 268 pages. Barcode 2020010004552   Scan available.

857. Brajavilaasa  gan'gaavishhnd-u shriikrxshhnd-adaasa; Language. Linguistics. Literature, 1894, laqs-miiveng-kat'eshvara chhaapaakhaanaa, 245 pages. Barcode 5010010012350   Scan not available.

858. Bran'hmaan'd'a Puraand-amu  je.yal. shaastri; Religion. Theology, 1983, Motilal Banarasidass Publishers Private Limited, Delhi, 315 pages. Barcode 5010010025673   Scan not available.

859. brhadaarand-yakopanishhatu  Vira Raghavachaya.t; Upanishads, 1954, T.T.D Tirupati, 278 pages. Barcode 5010010000558   Server error, availability unknown.

860. Brhadaranyakopanishad Bhasyam  Unknown; General, 999, Unknown, 914 pages. Barcode 5010010010816   Scan not available.

861. Brhadavanyaka Bhava Botha  Unknown; Unknown, 999, Unknown, 753 pages. Barcode 5010010010815   Scan not available.

862. Brhajjatakam Bahotpala Tika  Unknown; Unknown, 1886, Unknown, 351 pages. Barcode 5010010010814   Scan not available.

863. Brhamasuutra Vrutti  balagangadar tilak l; Language. Linguistics. Literature, 1957, g c tilak pune, 198 pages. Barcode 2020050036074   Scan not available.

864. Brhaspatismrti  k. v. rangaswami aiyangar; Language. Linguistics. Literature, 1941, oriental institute barooda, 188 pages. Barcode 5010010017736   Scan not available.

865. Brihadaranyakopanishad - Bhashya  Vira Raghavachaya.t; Upanishads, 1954, T.T.D Tirupati, 614 pages. Barcode 5010010000557   Scan not available.

866. Brihadaranyakopanishad Bhasya Part 1  T Veeraraghavacharya; Unknown, 1954, T.T.D Tirupati, 616 pages. Barcode 2020010004563   Scan available.

867. brihadaranyakopanishhat'a khandarthaa  Sri Raghavendra Tirtha; Unknown, 0, G.R.Savanur.Dharvar, 295 pages. Barcode 5010010000556   Server error, availability unknown.

868. Brihat Sarvanukramnika Of The Atharva Veda  Pandit Ramgopal Shastri; Unknown, 1922, -, 282 pages. Barcode 2020010004567   Scan available.

869. Bruhaddevagnanaranganam  jyotirvdaya datta; Unknown, 1994, somaraj shri krishna das, 334 pages. Barcode 2020010004571   Scan available.

870. Bruhadh Hodachakra Vivaranamulu  Sri muralidhar; Religion. Theology, 999, -, 56 pages. Barcode 2020050017204   Scan available.

871. bruhadhyaavanaajaathakama  Jwalaprasad Misra; Art, 1875, Lakshmi Venkateswara Steam Press,Mumbai, 158 pages. Barcode 5010010004349   Server error, availability unknown.

872. Bruhajjyothi Sarnava (Mirra Skandha) Hari Krishna  Unknown; Religion. Theology, 999, Unknown, 190 pages. Barcode 5010010010810   Scan not available.

873. Bruhanigantu Rathnakara Panchama Bagh  Sri Krishnalal Thanaya Datt; Unknown, 1980, Srikrishnadasatjmaja_Ganga_Vishnu, 926 pages. Barcode 2020010004573   Scan available.

874. Bruhat Samudrika Sastramu  -; Religion. Theology, 999, -, 216 pages. Barcode 2020050017218   Scan available.

875. bruuhatsan'hitaa  vidyaasaagara bhat'aachaaryaa; Religion, 1921, , 284 pages. Barcode 5010010087253   Scan not available.

876. Brxhadaarand-ya Kopanishhadabhaashhya Vaara~tikama~ Prathamo Bhaaga Grantha 16  Chaara~ya Matsureshvaraa; Religion. Theology, 1937, Aanandaashramamudrand-aalaye, 385 pages. Barcode 2030020016144   Scan not available.

877. Brxhadaarand-yakopanishata~  Shaastrii Kashiinaatha; Religion. Theology, 1953, Aanandaashramamudrand-aalaye, 880 pages. Barcode 2030020016208   Scan not available.

878. Brxhadaarand-yakopanishhatkhan'd'a  Not available; Language. Linguistics. Literature, 0, Not available, 290 pages. Barcode 5010010018027   Scan not available.

879. Brxhaddhaan'turuupaavali  t'ii aara krxshhnd-aachaaryand-a; Language. Linguistics. Literature, 1924, The Bhaskara Press , Trivandrum ., 643 pages. Barcode 5010010012549   Scan not available.

880. Brxhadhdaan'turuupaavali  t'i aar krxshhnd-aachaarya; Language. Linguistics. Literature, 1843, anantashayanasthe bhaaskara mutrand-ayantralaya, 643 pages. Barcode 5010010017393   Scan not available.

881. Brxhadhyogatarang-agind-ii Dvitiiyobhaaga  trimallabhat't'a; Language. Linguistics. Literature, 1914, aanandaashramamudrand-aalaya, 560 pages. Barcode 5010010025676   Scan not available.

882. brxhat indrajaala  khemaraaja shriikrxshhnd-adaasa; Literature, 1877, Sri venkateswara Steam Press , Mumbai, 394 pages. Barcode 5010010092017   Scan available.

883. Brxhatakathaaman'jarii  qs-hemendra; LANGUAGE. LINGUISTICS. LITERATURE, 1901, Tukaram Javaji,Bombay, 664 pages. Barcode 5010010042442   Scan not available.

884. brxhatasan'hita  varaaha mitra; Literature, 1895, Not available, 663 pages. Barcode 5010010092097   Scan available.

885. brxhatasan'hita bhaaga 1  varaaha mitra; Literature, 1897, Not available, 663 pages. Barcode 5010010092132   Scan available.

886. Brxhatii Prabhaakaramishraprand-iitaa Prathamo Bhaaga  Prabhaakaramishra; Language. Linguistics. Literature, 1934, Madrapuriyavishvavidhyaalaya, 437 pages. Barcode 2030020015974   Scan not available.

887. Brxhatii Prabhaakaramishraprand-iitama Da~tiiyo Bhaaga  Prabhaakaramishra; Philosophy. Psychology, 1936, Madrapuriivishvavidhyaalaya, 225 pages. Barcode 2030020016351   Scan not available.

888. Brxhatii Shaabarabhaashhyavyaakhyaa  prabhaakaramishra; Language. Linguistics. Literature, 1933, chaukhambhaa san'skrxta san'sthaana, vaaraand-asii, 110 pages. Barcode 5010010028313   Scan not available.

889. brxhatkathaaman'jarii  shrii kshhemendra; Literature, 1867, Not available, 616 pages. Barcode 5010010092126   Scan available.

890. Brxhatparaasharaherashaastramu  madhurakrishnamurthy sastry; General, 2005, jypthisha vignana kandramu rajamahendravaram, 408 pages. Barcode 2020050017222   Scan available.

891. Brxhatstotraratnaakara Sachitra  Not available; Language. Linguistics. Literature, 1979, shriiveng-kat'eshvara presa bambayii, 256 pages. Barcode 5010010025852   Scan not available.

892. Buddhapalita Mulamadhyamakavrtti  Max Walleser; Unknown, 1992, Motilal_Banarsidass_Publishers, 206 pages. Barcode 2020010004585   Scan available.

893. Buddhist Avadanas  Dr.sharmistha Sharma; Unknown, 1986, Eastern Book Linkers, 214 pages. Barcode 2020010004586   Scan available.

894. Buddhist Hybrid Sanskrit Reader  Franklin Edgerton; Unknown, 1953, YALE UNIVERSITY PRESS, 110 pages. Barcode 2020010004587   Scan available.

895. Buddhist Logic Vol 1  Stcherbatsky; Philosophy, 1992, Motilal_Banarsidass_Publishers, 580 pages. Barcode 2020010004588   Scan available.

896. Buddhist Technical Terms  Kenjiu Kasawara; Unknown, 1885, Oriental Publishing, 86 pages. Barcode 2020010004590   Scan available.

897. Buddhist'a T'eksat'a Ashokaa  Bhat't'achaara~yaa Vidhu Shekharaa; Religion. Theology, 1948, Nishita Chandra Sena, 73 pages. Barcode 2030020016137   Scan not available.

898. Budgat 1966-67 Finance Minister's Speech Part -a  kaviraj shrii athrii dhev guru; Language. Linguistics. Literature, 0, jaikrushnadas haridas press, 34 pages. Barcode 2020050058051   Scan not available.

899. Budhabhushhand-ama~  Shambhu Shriimada~; Philosophy. Psychology, 1926, Da band'arakara~ Inst'ityuta~ Presa~, 132 pages. Barcode 2030020016442   Scan not available.

900. Budhabhushhnd-ama~  Shriimachchhan'bhunrxpa; Philosophy. Psychology, 1926, Ban'd'arakara Orien't'ala Risera~cha Inst'ityuta~, 132 pages. Barcode 2030020016332   Scan not available.

901. Budhabhuushhand-aman  King Sambhu; Philosophy. Psychology, 1926, Bhandarkar Oriental Institute, Poona, 122 pages. Barcode 5010010027934   Scan not available.

902. Bugusamhita Mahashastra Palitha Kanda  Unknown; Unknown, 999, Unknown, 613 pages. Barcode 5010010010808   Scan not available.

903. Bugusamhitargata Yogavali  Somraj Krishna Das; Unknown, 999, Sri Venkateshwara Steam Press, Mumbai, 343 pages. Barcode 5010010010807   Scan not available.

904. Buhadaarand-yakopanishhadushhyavaatokamuu  chimand-aajii aapat'e; RELIGION. THEOLOGY, 1891, Ananda Mudranalayamu , Madras, 330 pages. Barcode 5010010042416   Scan not available.

905. Buhadaarnd-yakopanishhanmitaaqs-araa  hari naaraayand-a; RELIGION. THEOLOGY, 1895, Not Available, 283 pages. Barcode 5010010042362   Scan not available.

906. Bulletin Of The Goverment Oriental Manuscripts Library Madras  t. chandrashekhran; Language. Linguistics. Literature, 1955, the superident government press, 132 pages. Barcode 2020050058049   Scan not available.

907. buuhadaarand-yakopanishhadraashhyavaartikamuu  mahaadeva chimand-aajii aapat'e; Religion, 1921, , 1709 pages. Barcode 5010010087206   Scan not available.

Return to the top

C


908. Calcutta Sanskrit Series  Pandit Amareswar Thakur; Unknown, 1934, Metropolitan_Printing_ _Publishing_House_Limited, 830 pages. Barcode 2020010004596   Scan available.

909. Camatkarachandrika Of Visvesvarakavichandra  Dr P Sri Rama Murhy; Unknown, 1969, ANDHRA UNIVERSITY, 270 pages. Barcode 2020010004599   Scan available.

910. Canakya-caritam  Dr.thakur Prasad Mishra; Unknown, 1981, Krishna_Academy_Varanasi, 180 pages. Barcode 2020010010998   Server error, availability unknown.

911. Candravyakarana Of Candragomi  K C Chatterji; Language. Linguistics. Literature, 1953, Deccan College Postgraduate And Research Institute , Pune ., 360 pages. Barcode 5010010012650   Scan not available.

912. Carudattam Edition I I  C R Devadhar; Unknown, 1943, ORIENTAL BOOK AGENCY, 136 pages. Barcode 2020010004605   Scan available.

913. Catalogue Of Sanskrit And Pali Books In The British Museum  Dr Ernst Haas; General, 1876, LONDON: TRUBNER amp CO, 199 pages. Barcode 2020050022399   Scan not available.

914. Catalogue Of Sanskrit Manucripts In The India Office Part1  Julius; Religion. Theology, 1887, India Council,Benares, 163 pages. Barcode 5010010010893   Scan not available.

915. Catalogue Of Sanskrit Manucripts In The India Office Part2  Julius; Religion. Theology, 1889, India Council,Benares, 169 pages. Barcode 5010010010894   Scan not available.

916. Catalogue Of Sanskrit Manucripts In The India Office Part5  Julius; Religion. Theology, 1896, India Council,Benares, 237 pages. Barcode 5010010010890   Scan not available.

917. Catalogue Of Sanskrit Manuscripts In The Govt Oriental Library , Mysore  Raajakiiya Praachyakeishaagaassat'aa; LANGUAGE. LINGUISTICS. LITERATURE, 1922, The Government Branch Press , Mysore, 359 pages. Barcode 5010010078023   Scan available.

918. Catalogue Of Sanskrit Pali And Prakrit Books Vol-i  -; Unknown, 1951, By_The_Librarian_National_Library, 354 pages. Barcode 2020010004608   Scan available.

919. Catalogue Of The Sanskrit Manuscripts In The Library Of The India Office Part Iii  Julius; Religion. Theology, 1891, India Council,Benares, 282 pages. Barcode 5010010010889   Scan not available.

920. Catalogus Catalogorum An Alphabetical Register Of Sanskrit Works And Authors  Theodor Aufrecht; Religion. Theology, 1903, Leipzig Otto harrassowitz, 170 pages. Barcode 5010010004750   Server error, availability unknown.

921. Catalouge Of Sanskrit Parakrit Manuscripts Vol 3  Muniraja Sri Punyavijayajit; Unknown, 1968, Bharatiya_Sanskrit_Vidyamandira, 368 pages. Barcode 2020010004609   Scan available.

922. Census Of India 1981 Series 1 Part V A Amp B  p.padmanaabha; Language. Linguistics. Literature, 0, sri balamanorama press mylapore madras, 1326 pages. Barcode 2020050058040   Scan not available.

923. Census Of India 1981 Series 1 Part Viii  p.padmanaabha; Language. Linguistics. Literature, 0, sri balamanorama press mylapore madras, 1246 pages. Barcode 2020050058041   Scan not available.

924. Chaalukyacharitamu  Not available; Language. Linguistics. Literature, 0, Not available, 82 pages. Barcode 5010010024451   Scan not available.

925. Chaand-akyashatakam  P.viswanatha Nayak; Social Sciences, 1107, P.Narayana Nayak, 32 pages. Barcode 5010010027955   Scan not available.

926. chaarudattan'  ta. gand-apatishaastrind-aa; Literature, 1914, Rajakeeya Press, 102 pages. Barcode 5010010092053   Scan available.

927. Chaitanyachandroday Naam Natakam  Sri Rajendra Lal Mitrena; Unknown, 999, MAHJANPADE VAPRISHTABHISHNAM YANTHRALAY, 294 pages. Barcode 2020010004619   Scan available.

928. chalaraashikalanama  ma.ma.sudhaakara diveidi; Natural Sciences, 1943, Pandit Baladeva Mishra Sarasvati Bhavana ,Benares, 290 pages. Barcode 5010010026482   Scan not available.

929. Chamatkaar  Dr Krishna Lal; Unknown, 1985, EASTERN BOOK LINKERS, 112 pages. Barcode 2020010004627   Scan available.

930. Chamatkaara Chintaamand-i  malaviyadaivajna dharmesvara; General, 2005, motilal banarasidas, 556 pages. Barcode 2020050017209   Scan available.

931. Chamatkara Chintamani  bhatta narayana; Unknown, 1964, motilal banarsidas, 550 pages. Barcode 2020010004628   Scan available.

932. Champubhaaratamu  shriiraamachandra budheindra; Language. Linguistics. Literature, 0, Not available, 460 pages. Barcode 5010010012352   Scan not available.

933. Champuramayana  narayana raam acharya; Religion. Theology, 1946, n s prakashan, 480 pages. Barcode 2020050058010   Scan not available.

934. Champuramayana Kiskindha Kanda And Sundara Kanda  bhoja; Language. Linguistics. Literature, 1941, sri balamanorama press mylapore madras, 256 pages. Barcode 2020050058038   Scan not available.

935. Champuuraamaayand-amu Ayodhyaakaand-d'amu  Not available; Language. Linguistics. Literature, 0, Not available, 552 pages. Barcode 5010010025853   Scan not available.

936. Champuuraamaayand-amu Kalyaand-ii San'skrxta Hindiivyaakhyaadvayopetamu  shriibhoojaraajasaarvabhauma; Language. Linguistics. Literature, 1979, chaukhambaa amarabhaaratii prakaashana, vaaraand-asii, 650 pages. Barcode 5010010025854   Scan not available.

937. Champuuraamaayand-amu Yuddhakaand-d'amu Vyakhyaaya Sametamu  shriibhojaraajasaarvabhauma; Language. Linguistics. Literature, 1937, nirnayasagar press, bombay, 398 pages. Barcode 5010010025855   Scan not available.

938. Champuuraamaayand-amuu Baalakaand-d'amuu  shriibhoojaraaja; Language. Linguistics. Literature, 0, Not available, 394 pages. Barcode 5010010018029   Scan not available.

939. Chan'drikaaprakaashaprasara  Not available; Language. Linguistics. Literature, 1843, ben'jal'uuru presuu, 461 pages. Barcode 5010010017970   Scan not available.

940. Chan'drikaaprakaashaprasara  shriimattaatparya; Language. Linguistics. Literature, 1843, ben'gal'uuru presa, 142 pages. Barcode 5010010026051   Scan not available.

941. Chanakyasuthram Part 1  Pandit Vijendermisra; Unknown, 1665, Coukamba_Samskruth_Sirij_Office, 48 pages. Barcode 2020010011038   Server error, availability unknown.

942. chand-d'akaushika  vidyaasaagara bhat'at'aachaarya; Literature, 1884, Kalakatta Printing Press , Kalakatta, 144 pages. Barcode 5010010092101   Scan available.

943. Chandas Sastram  Sri Pingalacahrya; Unknown, 2002, PARIMAL PUBLICATIONS, 321 pages. Barcode 2020010011039   Server error, availability unknown.

944. Chandha Shastramu  Sri Pingali Nagh; Unknown, 999, Parimal_Publications, 326 pages. Barcode 2020010004637   Scan available.

945. Chandogya Panisad Bashyam Pradhama Bagamu  Sri Ranga Ramanuja Muni; Unknown, 1952, T.T.D Tirupati, 546 pages. Barcode 2020010004639   Scan available.

946. Chandogyopanishad  Sri Ranga Ramanuja Muni; Unknown, 1952, T.T.D Tirupati, 596 pages. Barcode 2020010004640   Scan available.

947. Chandologyopanishad  Venkata Subramanyam Sastri.m; Ayurveda, 1924, Geeta_Prakash_Gorakpur, 939 pages. Barcode 5010010004753   Server error, availability unknown.

948. Chandra Loka  paurnamasi katha bhatta; Language. Linguistics. Literature, 1960, chowkhamba sanskrit series office varanasi, 342 pages. Barcode 2020050036396   Scan not available.

949. Chandraaloka Savimarsha Prakaasha Hindiivyaakhyaya Panj-chamo Mayuukha  shriijayadevakavi; Language. Linguistics. Literature, 1977, chaukhambhaa san'skrxta san'sthaana vaaraand-asii, 126 pages. Barcode 5010010026052   Scan not available.

950. Chandrakaantaa Santati Paan'chavaan' Hissaa  devakiinandana; LANGUAGE. LINGUISTICS. LITERATURE, 1912, Lahari Press , Benares, 115 pages. Barcode 5010010042419   Scan not available.

951. Chandrakaantaa Santati Saatavaan' Hissaa  devakiinandana; LANGUAGE. LINGUISTICS. LITERATURE, 1914, Lahari Press , Benares, 127 pages. Barcode 5010010042326   Scan not available.

952. Chandrakalodaahaara  Not available; Language. Linguistics. Literature, 0, Not available, 672 pages. Barcode 5010010018012   Scan not available.

953. Chandrapeeda Katha  Pandit V Ananthacharya; Unknown, 1946, Ram_Narainlal, 90 pages. Barcode 2020010004644   Scan available.

954. Chandraprabha Charita  viiranandii; Language. Linguistics. Literature, 1926, nirnayasagar press, bombay, 184 pages. Barcode 5010010026053   Scan not available.

955. Chandraprabha Charithramu  P.amruthlal Jain; Unknown, 1954, Chaukhamba Sanskrit Series, 34 pages. Barcode 2020010004645   Scan available.

956. Chandrasyasaarand-iiraashyaadi  Not available; Language. Linguistics. Literature, 0, Not available, 37 pages. Barcode 5010010026054   Scan not available.

957. Chandrika Sahitha Kuvalayananda  Unknown; Religion. Theology, 999, Unknown, 328 pages. Barcode 5010010010804   Scan not available.

958. Charak Saheta Vol 3  Sri Narendrasen Gupt; Unknown, 999, SEN ERED COMPANY LTD, 664 pages. Barcode 2020010011050   Server error, availability unknown.

959. Charaka 1  -; Unknown, 999, -, 502 pages. Barcode 2020010011048   Server error, availability unknown.

960. Charaka 5  -; Unknown, 999, -, 626 pages. Barcode 2020010011049   Server error, availability unknown.

961. Charaka Samhita 3  -; Unknown, 999, Chowmbika, 326 pages. Barcode 2020010004649   Scan available.

962. Charaka Samhita 6  -; Unknown, 999, Chowmbika, 534 pages. Barcode 2020010004650   Scan available.

963. charakasn'hitaa by agnivesha  Chakripanidatta; Technology, 1941, Sathya Bhamabai Pandurang, Bombay, 810 pages. Barcode 5010010026481   Scan not available.

964. Charudattam  devadhar g r tr; Language. Linguistics. Literature, 1962, oriental book agency poona, 142 pages. Barcode 2020050036061   Scan not available.

965. chatun'shlokii  Sri Vallabhacharya; Unknown, 0, motamandir_Trust,Bombay, 88 pages. Barcode 5010010000596   Server error, availability unknown.

966. Chatur^thiikar^mapaddhati  Gopala Lala; Social Sciences, 1861, Not Available, 86 pages. Barcode 5010010033856   Scan not available.

967. Chatur^var^gachintaamand-e Part Ii  Hemadri; Social Sciences, 1959, Bhakari And Co. Benaras, 386 pages. Barcode 5010010033790   Scan not available.

968. Chaturdandi Prakaashika  subramanya shastri s; Language. Linguistics. Literature, 1934, mudrapurisangita vidvatsaba, 156 pages. Barcode 2020050058034   Scan not available.

969. Chaturdashalakshani With Didhiti,didhitiprakashka,vivarana  N.veejhinatha; Indian Logic, 1997, N.Veejhinatha, 867 pages. Barcode 5010010000597   Server error, availability unknown.

970. Chaturvaand-ii  Not available; Language. Linguistics. Literature, 0, Not available, 112 pages. Barcode 5010010024457   Scan not available.

971. Chaturvaand-ii  Not available; Language. Linguistics. Literature, 999, Not available, 112 pages. Barcode 5010010018519   Scan not available.

972. Chaturvin'shatiimatasan'graha  bhat't'oojidiikqs-ita; Language. Linguistics. Literature, 1907, Vidya Vilas Press, Benaras, 190 pages. Barcode 5010010028304   Scan not available.

973. Chatushshlekii Stotraratnanj-cha  shriimadyaamunamuni; Language. Linguistics. Literature, 0, r. venkateswara and co, madras, 108 pages. Barcode 5010010024458   Scan not available.

974. Chaukhaambaa Sahitya  Not Available; Language. Linguistics. Literature, 1962, Chowkamba Vidya Bhawan , Varanasi ., 230 pages. Barcode 5010010012354   Scan not available.

975. Chaukhambaa Saahitya  Not available; Language. Linguistics. Literature, 1993, chaukhambaa san'skrxta pratishht'haana dillii, 106 pages. Barcode 5010010024459   Scan not available.

976. Chaukhambaa Saahitya 1996 97  Not available; Language. Linguistics. Literature, 0, chaukhambhaa san'skrxta pratishht'haana, dillii, 112 pages. Barcode 5010010024460   Scan not available.

977. Chaukhambaa Saahitya 1996 97  Not available; Language. Linguistics. Literature, 0, chaukhambhaa san'skrxta pratishht'haana, dillii, 112 pages. Barcode 5010010026056   Scan not available.

978. Chaukhambaa Siiriija Saahitya 1999 Ii  Not available; Language. Linguistics. Literature, 1999, chaukhambaa san'skrxta siiriija aaphiisa vaaraand-aasii, 194 pages. Barcode 5010010028314   Scan not available.

979. Chhaan'dogyavedeshiiyat'iikaa  Krishnacharya,t.r; Unknown, 1904, Nirnaya Sagar Press,Mumbai, 526 pages. Barcode 5010010010805   Scan not available.

980. Chhaan'dogyavedeshiiyat'iikaa  Not available; Religion. Theology, 0, Not available, 322 pages. Barcode 5010010024463   Scan not available.

981. Chhaan'dogyopanishhatkhan'd'aartha  Not available; Religion. Theology, 0, Not available, 251 pages. Barcode 5010010018013   Scan not available.

982. Chhaandogya Braamhand-amu Trxtiiyobhaaga  Not available; Language. Linguistics. Literature, 1980, kumaara presu kun'bakond-amu, 212 pages. Barcode 5010010026057   Scan not available.

983. Chhaandogyopanishhata~  Upanishhata~; Religion. Theology, 1952, Viiraraaghavaachaara~ya, 549 pages. Barcode 2030020016036   Scan not available.

984. Chhaandogyopanishhata~ Grantha 14  Aapat'e Vinaayaka Gand-esha; Religion. Theology, 1934, Aanandaashramamudrand-aalaye, 539 pages. Barcode 2030020016180   Scan not available.

985. Chhaandogyopanishhata~ Grantha 79  Nityaananda; Religion. Theology, 1915, Aanandaashramamudrand-aalaye, 223 pages. Barcode 2030020016114   Scan not available.

986. Chhaandogyopanishhatuu  hari naaraayand-a aapat'e; RELIGION. THEOLOGY, 1902, Ananda Mudranalayamu , Madras, 530 pages. Barcode 5010010042311   Scan not available.

987. Chhaandogyopanishhatuu Saamaveidaa  shriijovaanandavidyasaagarabhat't'aachaaryaa; Language. Linguistics. Literature, 1873, suchaaroo pirasa, 645 pages. Barcode 5010010018014   Scan not available.

988. Chhaandoogyabraahmand-amuu  shrii durgaamoohanabhat't'aachaaryaind-a; Language. Linguistics. Literature, 1958, Sanskrit College , Kolkatta ., 256 pages. Barcode 5010010012649   Scan not available.

989. Chhanda Shaastrama~  Chaara~ya Pin'galaa; Language. Linguistics. Literature, 1950, Bhagavaana~ Deva aachaara~ya, 272 pages. Barcode 2030020016096   Scan not available.

990. Chhanda Shaastramu Mrxtasan'jiivanyaa Vrxttii  shriiping-galaachaarya; Language. Linguistics. Literature, 1908, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 218 pages. Barcode 5010010025683   Scan not available.

991. Chhandas Sastra  sri pingalanaga; Language. Linguistics. Literature, 1938, pandurang jawaji bombay, 326 pages. Barcode 2020050036045   Scan not available.

992. Chhandashaastramu  shriiping-kalanaaga; Religion. Theology, 1938, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 322 pages. Barcode 5010010024464   Scan not available.

993. chhandobhyastaa  Sharma.m.s; Ayurveda, 1948, V.Ramaswamy Sastrulu amp Sons, Madras, 209 pages. Barcode 5010010006778   Scan not available.

994. chhandovichitin  B.r.sharma; Linguistics Literature, 2000, D.Prahladacharya, Tirupati, 244 pages. Barcode 5010010004755   Server error, availability unknown.

995. Chhatrapatisan'bhaajii Mahaaraaja  Rangand-ekara Keshavaman'gesha; Geography. Biography. History, 1950, Ema~ Sii Kot'haarii, 86 pages. Barcode 2030020016409   Scan not available.

996. Chidagaganachanddrikaa Kramaprakaashikaavyaakhyaaya  mahaakavikaalidaasa; Language. Linguistics. Literature, 1980, sampurnaanand sanskrit vishvavidyalaya, varanasi, 282 pages. Barcode 5010010025684   Scan not available.

997. Chidagana Chandrika Sanskrit Commentry And English Translation  kalidasa; Language. Linguistics. Literature, 1943, cheekoty veernnah and sons secunderabad, 208 pages. Barcode 2020050057987   Scan not available.

998. Chidgagana Chandrika  Kalidas; Unknown, 1943, -, 208 pages. Barcode 2020010004707   Scan available.

999. Chikitsaa Saahitya  shriitaaraanaathatakivaacha; Technology, 1962, Chowkamba samskruth pustakalayamu, Banras, 82 pages. Barcode 5010010032593   Scan not available.

1000. Ching-iyaaghara  pan' harishang-kara sharmma; Language. Linguistics. Literature, 1971, gayaaprasaada end-d'a sn'sa, 125 pages. Barcode 5010010012355   Scan not available.

1001. Chitra Champu  sriram charan; Unknown, 1862, sri harkumar chakravarthy, 146 pages. Barcode 2020010004738   Scan available.

1002. Chitra Prabha  Bhagavata Hari Sastri; Unknown, 1932, Andhra_University_Waltair, 480 pages. Barcode 2020010004739   Scan available.

1003. Chitramiimaan'saa  shivadat't'a; LANGUAGE. LINGUISTICS. LITERATURE, 1941, Nirnaya Sagar Press , Bombay, 162 pages. Barcode 5010010042519   Scan not available.

1004. Chitramiimaan'saa Sudhaa Vyaakhyaasamalang-krxtaa  shriimadappayadiiqs-ita; Language. Linguistics. Literature, 1965, vaarand-aseya san'skrxtavishvavidhyaalaya, 366 pages. Barcode 5010010025687   Scan not available.

1005. Chitramiimaan'saakhand-d'anamu Marmakaashena Vimarshinyaa Baalakriid'ayaa  mand-d'itaraaja shriijagannatha; Language. Linguistics. Literature, 0, Not available, 80 pages. Barcode 5010010025686   Scan not available.

1006. chitranibandhaavalin  Raghunath Sharma; The Four Vedas, 1964, Motilal Banarasidas, Delhi, 411 pages. Barcode 5010010000605   Server error, availability unknown.

1007. chitraprabhaa  Bhabgavata Hari Sastri; Psychology, 1932, BOBBILI ENDOWMENT FOR THE FURTHERENCE OF RESEARCH, WALTAIR, 459 pages. Barcode 5010010006794   Scan not available.

1008. Chitraprabhaa  subrahand-ya shaastrii; Language. Linguistics. Literature, 1932, Andhra University, Waltair, 470 pages. Barcode 5010010028315   Scan not available.

1009. Chitrasenapadmavati Charita  Mulraj Jain; Unknown, 1942, Jain_Vidya_Bhavan, 98 pages. Barcode 2020010004742   Scan available.

1010. Chittavishuddiprakarand-a  Aara~yadeva~; Religion. Theology, 1949, Vishva Bhaarati Shan'tiniketana~, 147 pages. Barcode 2030020016269   Scan not available.

1011. Chrak Samhitha Part 2  -; Unknown, 1950, -, 568 pages. Barcode 2020010011114   Server error, availability unknown.

1012. Chytanya Nandanam  Nistala Subramanyam; Unknown, 1987, Nistala_Subramanyam, 170 pages. Barcode 2020010004760   Scan available.

1013. Cikitsa Of Srinivasa  sri s venkatasubramanya sastri; Unknown, 1953, government oriental manuscripts library, 414 pages. Barcode 2020010004761   Scan available.

1014. Cikshasamuccaya  Canti Deva; Unknown, 1992, Mothilal_Banarsidass, 494 pages. Barcode 2020010004762   Scan available.

1015. Class 06 Sanskrit Ruchira Text Book  -; SANSKRIT, 2006, NCERT, 17 pages. Barcode 8000000000797   Scan not available.

1016. Class 07 Sanskrit Shreyasi  -; SANSKRIT, 2006, NCERT, 20 pages. Barcode 8000000000810   Scan not available.

1017. Class 09 Sanskrit Shemushi Prathmo Bhag  -; SANSKRIT, 2006, NCERT, 14 pages. Barcode 8000000000834   Scan not available.

1018. Class 10 Sanskrit Pragya Text Book  -; SANSKRIT, 2006, NCERT, 15 pages. Barcode 8000000000849   Scan not available.

1019. Class 11 Sanskrit Bhaswati  -; SANSKRIT, 2006, NCERT, 12 pages. Barcode 8000000000865   Scan not available.

1020. Class 11 Sanskrit Shashwati  -; SANSKRIT, 2006, NCERT, 18 pages. Barcode 8000000000876   Scan not available.

1021. Class 12 Sanskrit Mandakini  -; SANSKRIT, 2006, NCERT, 12 pages. Barcode 8000000000761   Scan not available.

1022. Cola Campu Of Virupaksa  T Chandra Shekaran; Unknown, 999, S GOPALAN T M S S M LIBRARY, 90 pages. Barcode 2020010004768   Scan available.

1023. Collected Papers Of Manavalli Ramakrishna Kavi  P S R Appa Rao; Unknown, 1986, TELUGU UNIVERSITY, 340 pages. Barcode 2020010004769   Scan available.

1024. Collection And Preservation Of The Records Of Ancient Sanskrit Literature  Not Available; Literature, 1920, Not Avalible, 242 pages. Barcode 5010010094784   Scan not available.

1025. Contribution Of Andhra To Sanskrit Literature  raamaraaju b; Language. Linguistics. Literature, 2002, b ramaraju, 830 pages. Barcode 2020050057950   Scan not available.

1026. Critical Study Of Vedarthasangraha  t v raghavacharyulu; Unknown, 1989, ramanuja publications, 250 pages. Barcode 2020010004789   Scan available.

Return to the top

D


1027. D'a Had'agevaara Charitra  Paalakara Naaraayand-ahari; Geography. Biography. History, 1882, Aanandaashramamudrand-aalayan', 538 pages. Barcode 2030020016460   Scan not available.

1028. D'anavaara Kii Ghaat'ii  vord'ana d'ila; Language. Linguistics. Literature, 0, laqs-miiveng-kat'eshvara chhaapaakhaanaa, 628 pages. Barcode 5010010012499   Scan not available.

1029. Da Aara~ya Shatakama~  Shriimadappayyadiiqs-ita; Philosophy. Psychology, 1944, Samara~tha Bhaarata Presa~, 72 pages. Barcode 2030020016544   Scan not available.

1030. Da Ethimalojiisa~ Apha~ Yaska  Vara~maa Siddheshvara~vara~maa; Language. Linguistics. Literature, 1953, Vi Vi Ara~ Inst'ityuta~ Presa~, 272 pages. Barcode 2030020016454   Scan not available.

1031. Da Jaataka Maalaa Prathama~ Bhaaga  Aara~ya Kuuraa; Philosophy. Psychology, 1943, Da Haara~vaad'a Yuunivara~sit'ii Presa~, 279 pages. Barcode 2030020016554   Scan not available.

1032. Da Katuhsataka Dvitiya Bhaaga  Ara~yadeva~; Religion. Theology, 1931, Vishva Bhaarati Buka~ Shapa~, 344 pages. Barcode 2030020016281   Scan not available.

1033. Da Mahaabhaarata Sabhaapara~va  Vishhnd-u Esa~ Suktaankara~; Language. Linguistics. Literature, 1943, Bhand-d'aara~kara~ orien't'ala~ Riisera~cha Inst'it'ut'a~, 217 pages. Barcode 2030020016556   Scan not available.

1034. Da Saundarananda  Ashvaghosha; Philosophy. Psychology, 1928, Aaksa~fora~d'a Yunivara~sitii Presa~, 200 pages. Barcode 2030020016433   Scan not available.

1035. Daa. Ketakara Vyaktti Aand-i Vichaara  Ketakara Shriidharavyan'kat'esh; Geography. Biography. History, 1955, Ga Paan' Parachure Prakaashana Mandira, 216 pages. Barcode 2030020016390   Scan not available.

1036. Daanachanddrikaa  divaakara; Language. Linguistics. Literature, 0, Not available, 213 pages. Barcode 5010010025691   Scan not available.

1037. Daanakaand-d'amu Panchamo Bhaagan  K.v. Rangaswamy; Language. Linguistics. Literature, 1941, Oriental Institute,Baroda, 579 pages. Barcode 5010010024666   Scan not available.

1038. daanakelichintaamand-in  Sri Gopala Shastri Darsanakesari; Religion, 1991, Sampurnananda_Sanskrit_University, 120 pages. Barcode 5010010000657   Server error, availability unknown.

1039. Daarshaanik Pancham Varshik Shanaak  yash dev shaalya; Vacant, 0, bhartiya darshan pariband, 152 pages. Barcode 2020050058003   Scan not available.

1040. daarubrahaa  Banamali Biswal; The History Of Philosophy, 2001, Padmaja prakasanam, Allahabad, 127 pages. Barcode 5010010000661   Server error, availability unknown.

1041. daasacharitamu  Ananthanarayana,t; The History Of Philosophy, 1989, S.V.U. Oriental Research Institute Tirupati, 232 pages. Barcode 5010010000662   Server error, availability unknown.

1042. Daasakuut'a  bhiqs-u; LANGUAGE. LINGUISTICS. LITERATURE, 1956, Pratibha Grandhamala , Dharvada, 160 pages. Barcode 5010010042984   Scan available.

1043. daasharuupama  dilananjaya; Literature, 1861, Baptist Mission Press , Calcutta, 288 pages. Barcode 5010010091952   Scan available.

1044. daayabhaaga'  jiivaanandavidyaasaagarabhat'aachaaryaa; Religion, 1563, , 228 pages. Barcode 5010010087217   Scan not available.

1045. daharavidhyaaprakaashikaa  Sri Paramasivendra Saraswati; Philosophy. Psychology, 1937, Sri Balamanorama Press, Chennai, 90 pages. Barcode 5010010026480   Scan not available.

1046. daivajnj-aakaamadhenu  mahaamahopaadhyaayena; Literature, 1906, Vidyavilas Chapkhana , Benares, 504 pages. Barcode 5010010091936   Scan available.

1047. Daivat Sanhita Vol-3  Sripad Damodar Saatvalekar; Unknown, 1948, Vasanth Sripad Saatvalekar, 284 pages. Barcode 2020010004798   Scan available.

1048. Daivata San'hita Prathama Bhaaga  Shriipaada Daamodara Saatavad'ekara bhat't'aachara~ya; Religion. Theology, 1941, Svadhyaaya Mand-d'ala Bhaaratamudrand-alaya Aun'dha, 987 pages. Barcode 2030020016207   Scan not available.

1049. Daivata San'hitaa Bhaaga 2  Saatavalekara Sriipaada Vasan'ta; Religion. Theology, 1943, svaadhyaaya mand-d'ala bhaaratamudrand-aalaya aun'dha, 923 pages. Barcode 2030020016214   Scan not available.

1050. Dakikhanii Kaa Padha Aura  shriiraama; LANGUAGE. LINGUISTICS. LITERATURE, 1954, Hindi Prachara Sabha , Hyderabad, 575 pages. Barcode 5010010042492   Scan not available.

1051. dakshhind-aapraija  krxshhnd-ashaastrii raajavaad'e; Literature, 1853, Pathashalakadil Chapkhane , Poone, 166 pages. Barcode 5010010091929   Scan available.

1052. dakshind-aamuurti stotramuu  shriishan'karaachaaryavirachitamuu; Religion, 1895, Government Branch Press, Mysore, 192 pages. Barcode 5010010087185   Scan not available.

1053. Damayanatiikathaa Athavaa Nalachumpuu  sretaarand-yanaaraayand-asharmaand-a; LANGUAGE. LINGUISTICS. LITERATURE, 1903, the royal victoria press, madras, 124 pages. Barcode 5010010078796   Scan available.

1054. Dandanitiprakaranam  V S Bendrey; Unknown, 1943, Sardar_G_N_Alias_Abasaheb_Majumdar, 144 pages. Barcode 2020010004807   Scan available.

1055. Daqs-ind-achyaa Mdhyayugiina Itihaasachi Sadhane Khan'd'a 2  khera~ Gand-eshaharii; Geography. Biography. History, 1934, Bhaarata Itihaasa San'shodhaka Man'd'ala, 119 pages. Barcode 2030020016376   Scan not available.

1056. Dara~sha Puura~nd-a Maasa Prakaasha Prathamo Bhaaga Grantha 93  Daad'ekaro Sarasvatii Bhushhand-a; Religion. Theology, 1924, Aanandaashramamudrand-aalaye, 652 pages. Barcode 2030020016175   Scan not available.

1057. Darsan Ka Prayojan  Bhagvan Das; The History Of Philosophy, 1987, BENNARAS, 312 pages. Barcode 5010010000660   Scan not available.

1058. Darsanodaya  lakshmipuram srinivasachar; Language. Linguistics. Literature, 1933, government branch press, mysore, 602 pages. Barcode 5010010025693   Scan not available.

1059. Darshapuurnd-amaasaprakaasha Prathamo Bhaaga  vinaayaka gand-esha aapat'e; Religion. Theology, 1924, aanandaashramamudrand-aalaya, 652 pages. Barcode 5010010024475   Scan not available.

1060. Das Gopatha Brahmana  Dieke Gaastra; Unknown, 1919, Buchhandlung_Und_Druckerei, 360 pages. Barcode 2020010004821   Scan available.

1061. Das Purana Pancalaksana  Wllibald Kirfel; Unknown, 1927, E.J.Brill, 664 pages. Barcode 2020010004828   Scan available.

1062. Dasa Charitam  Sri Sailusuri; Unknown, 1989, Sri_Venkateswara_University, 232 pages. Barcode 2020010004819   Scan available.

1063. Dasapadyunadivrtti No 81  Dr Mangal Deva Shastri; Unknown, 1943, Indian_Press_Limited, 578 pages. Barcode 2020010004820   Scan available.

1064. Dasha Upanishhada Prathamabhaaga Vyaakhyaayutaa  shrii upanishhadbrahmayogi; Religion. Theology, 1935, ad'ayaarupustakaalaya, 520 pages. Barcode 5010010025695   Scan not available.

1065. dasha upanishhadan' dhvitiyo bhaagan  C.kunhan Raja; Linguistics Literature, 1936, Adyar Library,Madras, 631 pages. Barcode 5010010004813   Server error, availability unknown.

1066. dasha upanishhadan' pradamo bhaagan  C.kunham Raja; Upanishads, 1936, ADAYAR LIBRARY, 518 pages. Barcode 5010010000668   Server error, availability unknown.

1067. dasha upanishhadan' pradhamo bhaagan  C. Kunham Raja; Upanishads, 1935, The Adyar Library( The Osophical Society) Madras, 519 pages. Barcode 5010010004814   Server error, availability unknown.

1068. Dashaa Kumaaraa Kathaa Saaraa  Appaayaamatya; General, 1949, Adayara Laibraarii, 39 pages. Barcode 2030020016106   Scan not available.

1069. dashaakrumaaracharitan' sat'ikamu II  pit'ara pit'arasana; LANGUAGE. LINGUISTICS. LITERATURE, 1891, Government Central Book Depot, Bombay, 84 pages. Barcode 5010010032872   Server error, availability unknown.

1070. dashaavataarastotramu  G.achari; Art, 1928, SREE VANI VILAS MUDRALAYA, SREERANGAM, 120 pages. Barcode 5010010006817   Scan not available.

1071. dashainashaastrasyaitihaasan  Dr.shashibala Gouda; The History Of Philosophy, 1987, Chaukhamba_Surabharati_Prakashan, 131 pages. Barcode 5010010000659   Server error, availability unknown.

1072. dashanind-aiyai  Venkatanathacharya; Philosophy, 1998, Sri Ahobila Mutt,Mumbai, 341 pages. Barcode 5010010006813   Scan not available.

1073. Dashanirnd-ayii  shriivaidikasaarvabhaumai; Language. Linguistics. Literature, 1998, shriimadahoobilamat'hamu, 352 pages. Barcode 5010010018015   Scan not available.

1074. Dasharsurpakamuu  keshavaraava musalagaavakara:; General, 2005, chokhambhaa saskruuta bhavana, 574 pages. Barcode 2020050017207   Scan available.

1075. dasharuupakam  kaashiinaatha paand-d'uran'ga parava; Literature, 1819, Nirnayasagar Press , Mumbai, 541 pages. Barcode 5010010092109   Scan available.

1076. Dasharuupakamu Kaavalokaaravya T'iikaa Sahitamu  dhananj-jaya; Language. Linguistics. Literature, 1878, kalikaataa nagare sarasvatii yantre, 202 pages. Barcode 5010010025694   Scan not available.

1077. Dashopanishhada Grantha 106  Maarulakara Shan'kara Shaastrii; Religion. Theology, 1937, Aanandaashramamudrand-aalaye, 227 pages. Barcode 2030020016118   Scan not available.

1078. Dasopanishadas Vol 1  C.kunhan Raja; Unknown, 1935, Published By The Adyar Library, 520 pages. Barcode 2020010004826   Scan available.

1079. Dasopanishads Vol Ii  The Pandits Of The Adyar Library; Unknown, 1936, The Adyar Library, 644 pages. Barcode 2020010004827   Scan available.

1080. Dasopanishads Vol-1  C.kunhan Raja; Upanishads, 1935, THE ADYAR LIBRARY( THE OSOPHICAL SOCIETY), MADRAS, 519 pages. Barcode 5010010000666   Scan not available.

1081. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin  C.kunham Raja; Upanishads, 1936, ADAYAR LIBRARY, 518 pages. Barcode 5010010000667   Scan not available.

1082. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin  G. Achari; Art, 1936, ADAYAR LIBRARY, 518 pages. Barcode 5010010006818   Scan not available.

1083. Dathu Rathnakara  Sri Madwi Jayalavanya Soori; Unknown, 999, Vadilal_Bapulal_Shah, 348 pages. Barcode 2020010004830   Scan available.

1084. Dattaka Chan'drika  ke. maarulkarashaastri; Language. Linguistics. Literature, 1947, aashama Mudranalaya, 126 pages. Barcode 5010010025678   Scan not available.

1085. Dattakamiimaan'saa Grantha 116  Nanda Pand-d'ita; Religion. Theology, 1954, Aanandaashramamudrand-aalaye, 379 pages. Barcode 2030020016168   Scan not available.

1086. Dattakamimaan'saa 1976  mahaadeiva chimand-aajii aapt'e; Language. Linguistics. Literature, 1976, Ananda sama Mudranalaya, Madras, 370 pages. Barcode 5010010028305   Scan not available.

1087. Dattapuranam  Swami Vasudevananda Saraswathi; Unknown, 2004, Krishnadas_Academy, 736 pages. Barcode 2020010004831   Scan available.

1088. Ddvaitokttiratnamaalaa  naabaadarsgabaoaranaachaaryya; Religion. Theology, 0, shriishriijiivakaavya vyaakarand-atiirthabhat't'aachaarya, 130 pages. Barcode 5010010024478   Scan not available.

1089. Deha Prakriti Vignyan  yashaavanth vaasudhev paatnkar; Language. Linguistics. Literature, 0, the post graduation training centre in ayurvedha, 106 pages. Barcode 2020050058028   Scan not available.

1090. Deishopadeisha Namiimaalaagranthai  pandit madhusudan kaul shastri; LANGUAGE. LINGUISTICS. LITERATURE, 1923, The Aryabhushan Press,Poona, 102 pages. Barcode 5010010078714   Scan available.

1091. Descriptive Catalogue  K.s.ramamurthi; Upanishads, 1993, S.V.U. Oriental Research Institute Tirupati, 111 pages. Barcode 5010010000670   Scan not available.

1092. Descriptive Catalogue Of The Government Collections Of Manuscripts Jaina Literature And Philosophy Vol Xvii  Harilal Rasikdas Kapadia; Unknown, 1954, Bhandarkar_Oriental_Research_Institute, 330 pages. Barcode 2020010004844   Scan available.

1093. Descriptive Catalogue Vol I  Dr.k.s.ramamurthi; Religion, 1993, S.V.U. Oriental Research Institute Tirupati, 222 pages. Barcode 5010010000673   Scan not available.

1094. Deshabhakta Krxshhnd-aajii Prabhaakara Uura~pha Kaakaasaheba Khaad'ilakara Charitra  Khaad'ilakara Kaashinaathahari; Geography. Biography. History, 1949, Chitrashaalaa Presa~, 428 pages. Barcode 2030020016455   Scan not available.

1095. Deshabhaktta Saahityasamraat'a Narasin'ha Chin'taamand-a Kelakara Yaan'chyaa Aat'havand-ii  Baapat'a Sa Vi; Geography. Biography. History, 1945, Kesarii Mudrand-aalaya, 680 pages. Barcode 2030020016487   Scan not available.

1096. Deshii Naama Maalaa Dditiiya Khand-d'a  Hema Chandraa; Religion. Theology, 1938, Ven'kat'aa Raamaanujaa Svaamii, 523 pages. Barcode 2030020016090   Scan not available.

1097. Deshiinaamamaalaa  Hemaachandraa; Language. Linguistics. Literature, 1938, Ara~yabhushana~ presa~, 525 pages. Barcode 2030020016233   Scan not available.

1098. deshopadesha namaimaalaagrantho  Kashmir; Bhagavdgita, 1934, BOBBILI ENDOWMENT FOR PRINTED AT THE ARYABHUSHAN PRESS, 101 pages. Barcode 5010010006828   Scan not available.

1099. Devabhaashhaa  kaviraja rakhaldaasa kavyaatiirtha; Language. Linguistics. Literature, 0, akhila bhaaratiiya samskrita rashtra bhaashhaa sammel'anamu, kalakattaa, 98 pages. Barcode 5010010024578   Scan not available.

1100. Devalaya Grama Mahatmyam  Balachandra Kavishvar; Unknown, 1827, Unknown, 277 pages. Barcode 5010010010803   Scan not available.

1101. Devanandamahakavya Of Sri Meghavijayopadhyaya  Pandit Bechardas.j. Doshi; Unknown, 1937, THE SANCHALAKA_SINGHI_JAINA GRANTHAMALA, 102 pages. Barcode 2020010004851   Scan available.

1102. devataadhyaaya san'hitopanishhadu van'sha braahamand-aani  B.ramachandra Sharma; Unknown, 1983, Kendriya Sanskrit Vidyapeetha Tirupathi, 254 pages. Barcode 5010010000676   Server error, availability unknown.

1103. Devatadhyaya Samhitipanisad Vamsa Brahmanas With Commentaries  Ballikoth Ramachandra Sharma; Unknown, 1965, Kendriya_Sanskrit_Vidyapeetha, 270 pages. Barcode 2020010004852   Scan available.

1104. Devatadhyaya Samhitopanisad Vamsa Brahmanas  B Ramachandra Sharma; Unknown, 1965, Kendriya_Sanskrit_Vidyapeetha, 264 pages. Barcode 2020010004853   Scan available.

1105. Devendra Mahakavyam  P.bhochardas Jeevraj Desi; Unknown, 999, Sanchalak_Sindhi_Jain_Granthmala, 114 pages. Barcode 2020010004863   Scan available.

1106. Dhaara~mikavimara~shasamuchchaya  Bhaaratii Svaami Vidyashan'kara; Religion. Theology, 1944, Aanandaashramamudrand-aalaye, 237 pages. Barcode 2030020016290   Scan not available.

1107. dhaatu manjari  haridaasa; Religion, 1865, , 130 pages. Barcode 5010010087207   Scan not available.

1108. dhaatu rupaadarsha'  taranatha tarkayaghaspati; Religion, 1869, New Sanskrit Press, Calcutta, 288 pages. Barcode 5010010087243   Scan not available.

1109. Dhaatukoshaa  Shaastrii Baahuballabha; Language. Linguistics. Literature, 1912, Kalkattaa Yunivara~sitii Presa~, 288 pages. Barcode 2030020016475   Scan not available.

1110. Dhaaturatnaakara  vaad'iilaala; LANGUAGE. LINGUISTICS. LITERATURE, 0, Saraswati Pustak ,Bombay, 545 pages. Barcode 5010010042532   Scan not available.

1111. Dhaaturuupa Prakaashikoopoodhghaata  pan'd'it chamaraajanagar shriikaan'ta shaastri; Language. Linguistics. Literature, 1898, The Government Oriental Library ,Mysore ., 976 pages. Barcode 5010010012648   Scan not available.

1112. dhaaturuupaadarsha  upaadhidhaarind-aa; Literature, 1875, Kalakatta Printing Press , Kalakatta, 250 pages. Barcode 5010010092161   Scan available.

1113. Dhamaupadeshaamaalaa Vivarand-a  Sri Jayasimha Suri; Philosophy. Psychology, 1949, Bharatiya Vidya Bhavan, 290 pages. Barcode 5010010028002   Scan not available.

1114. Dhanan'jayavijayan  shriikaakhanaayai; Language. Linguistics. Literature, 1895, Tukaram Javaji,Bombay, 24 pages. Barcode 5010010032880   Scan not available.

1115. dhananjayavijaya'  taranathaa tarkavachaspati; Religion, 1871, Valmiki Press, Calcutta, 40 pages. Barcode 5010010087189   Scan not available.

1116. Dhanyaalokaa  Chaara~ya Aanan'davaradhana; Language. Linguistics. Literature, 1937, Jayaa Krxshhnd-a Daasa Haridaasa Guptaa, 149 pages. Barcode 2030020016089   Scan not available.

1117. dhar^makosha Part II  Sri Laxmanashastri Joshi; SOCIAL SCIENCES, 1938, Prajnapathashala Mandal, 2079 pages. Barcode 5010010030638   Server error, availability unknown.

1118. Dhar^masaastraa Part Ii  Manmatha Nath Dutt; Social Sciences, 1909, H. C. Dass, 426 pages. Barcode 5010010030671   Scan not available.

1119. dhar^masindhu  Sri Kasinath Upadhyaya; SOCIAL SCIENCES, 1936, Pandurang Javaji, 462 pages. Barcode 5010010033967   Server error, availability unknown.

1120. Dhara~ma Bin'duu  Hari Bhadraa; Religion. Theology, 1940, Royala Eshiyaat'ika Opha Sosaaiit'ii, 211 pages. Barcode 2030020016123   Scan not available.

1121. Dhara~matattvanind-ara~ya Prathamaa Bhaaga 1  Aapat'e Gand-osha Vinaayaka; Religion. Theology, 1929, Aanandaa Shramamudrand-alaye, 76 pages. Barcode 2030020016067   Scan not available.

1122. Dhara~matattvanind-ra~ya Parishishht'ama~ Bhaaga 2  Aapat'e Gand-osha Vinaayaka; Religion. Theology, 1935, Aanandaa Shramamudrand-alaye, 120 pages. Barcode 2030020016066   Scan not available.

1123. Dharma Kosah Vyavaharakanda Vyavaharamatrka Vol 1 Part 1  Laxmansastri Joshi; Unknown, 1937, PRAJNAPATHASALA MANDAL, 860 pages. Barcode 2020010004885   Scan available.

1124. Dharma Kuut'amu Vol. Iii Part Ii  tryamn'baka raayamakhi; Language. Linguistics. Literature, 1926, Sri Vani Vilas Press, Srirangam, 352 pages. Barcode 5010010028300   Scan not available.

1125. Dharma Shastra  Not available; Language. Linguistics. Literature, 0, Not available, 1111 pages. Barcode 5010010028306   Scan not available.

1126. Dharmaakuutamu 1 Baalakaand-d'a  Not available; Religion. Theology, 1996, shriivaand-ivilaasamudraayantraalaya, 402 pages. Barcode 5010010024483   Scan not available.

1127. Dharmaakuutamu 2 Ayodhyaakaand-d'a Prathamo Bhaaga  Not available; Religion. Theology, 1924, shriivaand-iivilasamudraalayamu, 363 pages. Barcode 5010010024484   Scan not available.

1128. Dharmaishaastrasan'graha  Unknown; Religion. Theology, 1970, Unknown, 640 pages. Barcode 5010010010802   Scan not available.

1129. Dharmakosa Upanisatkanda Vol 2 Part 2  laxmanshastri joshi; Unknown, 1949, prajna pathasala mandala, 544 pages. Barcode 2020010004886   Scan available.

1130. Dharmakosa Upanisatkanda Volume 2 Part 4  Laxmana Shastri Joshi; Unknown, 1953, Prajna_Pathasala_Mandala, 146 pages. Barcode 2020010004887   Scan available.

1131. Dharmakosa Vyavaharakhanda  laxman shastri joshi; Unknown, 1941, prajna pathasala mandala, 764 pages. Barcode 2020010004888   Scan available.

1132. Dharmakosha Varnd-aashramadharmakaand-d'amu Prathamo Bhaaga Kramaanka 5  laqs-mand-ashaastrii joshii; Language. Linguistics. Literature, 1988, prajnaa paat'ashaala mand'ala sataaraa, 855 pages. Barcode 5010010024485   Scan not available.

1133. Dharmakosha Vol I Part I  laqs-mand-a shaastrii; LANGUAGE. LINGUISTICS. LITERATURE, 1937, Prajnapathasala Mandala , Satara, 831 pages. Barcode 5010010042497   Scan not available.

1134. Dharmakosha Vol I Part Ii  laqs-mand-a shaastrii; LANGUAGE. LINGUISTICS. LITERATURE, 1938, Prajnapathasala Mandala , Satara, 1056 pages. Barcode 5010010042481   Scan not available.

1135. Dharmasharmaabhyudayamu  mahaakavishriiharichandra; Language. Linguistics. Literature, 1933, nirnayasagar press, bombay, 224 pages. Barcode 5010010025858   Scan not available.

1136. dharmashastra sangraha  ; Religion, 1876, Saraswati Press, Calcutta, 1295 pages. Barcode 5010010087230   Scan not available.

1137. Dharmasindhu  Khem Raj Krishna Das; Unknown, 999, Sri_Venkateswar_Steem_Press_Yantralay, 424 pages. Barcode 2020010004890   Scan available.

1138. Dharmasindhu Dharmadiipiikaa Vishaadahindiivyaakhyaaya Sudhaat'iippand-ya  shriikaashiinaathopaadhyaaya; Language. Linguistics. Literature, 1968, chaukhambhaa san'skrxta pratishht'haana, dillii, 1050 pages. Barcode 5010010028322   Scan not available.

1139. Dharmasuutra  gautama; Language. Linguistics. Literature, 1832, aanandaashramamudrand-aalayamu, 250 pages. Barcode 5010010017737   Scan not available.

1140. Dharmasuutramu Bhaashhya Sahitamu  gautama; Language. Linguistics. Literature, 1969, vedamitra and sons new delhi, 504 pages. Barcode 5010010025860   Scan not available.

1141. dharmasuutramuu  haradatta misra; Religion, 1891, Sri Vidya Press, Kumbakonam, 604 pages. Barcode 5010010087233   Scan not available.

1142. Dharmatattvanirnd-ayaparishishht'amu  mahaamahopaadhyaaya vaasudevashaastrii; Language. Linguistics. Literature, 1935, aanandaashramamudrand-aalaya, 98 pages. Barcode 5010010028175   Scan not available.

1143. Dharmikvimarsamuchya Vol I I  Pandith Marulkaropahvanar Hari Shastry; Unknown, 0, Navahind_Publications, 352 pages. Barcode 2020010004891   Scan not available.

1144. Dharmoottarapradiipa Volume Ii  pan'd'ita durveika mishraa; Language. Linguistics. Literature, 1955, Kashiprasad Jayaswal Research Institute , Patna ., 390 pages. Barcode 5010010012647   Scan not available.

1145. Dhathuratnakarah Shasthi Vibhagah  vadilal bapulal shah; Unknown, 999, saraswathi jain pusthak bhandar, 216 pages. Barcode 2020010004895   Scan available.

1146. Dhatu Sagara Tarani  sripati sastry; Vacant, 1968, the little flower co madras, 200 pages. Barcode 2020050036070   Scan not available.

1147. Dhatu Sagara Tarani  sripati sastry; Vacant, 1968, the little flower co madras, 116 pages. Barcode 2020050036071   Scan not available.

1148. Dhaturoop Sangraha  Charandas Shastry; Unknown, 999, Bharatiya_Sanskrit_Bhavan, 463 pages. Barcode 2020010004896   Scan available.

1149. Dhaturupa Manjari  K.l.v.sastri; Unknown, 2001, R.S.VADHYA amp SONS, 167 pages. Barcode 2020010011266   Server error, availability unknown.

1150. Dhatvarthavijnanam  Dr.bhagiratha Prasada Triputhi Vagisa Sastri; Unknown, 1980, Sampurnanand Sanskrit Vishvavidyalaya, 320 pages. Barcode 2020010011267   Server error, availability unknown.

1151. Dhavnalokha  Dr Nagendhra; Unknown, 1942, Janamandal_Ltd_Varnasi, 415 pages. Barcode 2020010011278   Server error, availability unknown.

1152. Dhavnyaloksar  Sri Purshoutam Sharma Chaturvedi; Unknown, 1977, CHOUKHAMBA SANSKRIT SERIES OFFICE,VARANASI, 109 pages. Barcode 2020010011268   Server error, availability unknown.

1153. Dhvaivajnj-abharanamu  p. p. lakshminarayana; Language. Linguistics. Literature, 1954, oriental manuscripts library, madras, 270 pages. Barcode 5010010028307   Scan not available.

1154. Dhvani Vicara  N G Kalelkar; Unknown, 1955, Deccan_College, 232 pages. Barcode 2020010004904   Scan available.

1155. Dhvanyaa Looka  shrii badhiriinaatha sharma; Language. Linguistics. Literature, 1971, Chowkamba Samskruta Sirij Office, Varanasi, 712 pages. Barcode 5010010025863   Scan not available.

1156. Dhvanyaaloka Baalapriyaadivyaanj-janaabhyaan' Lochanena  shriimadaanandavardhanaachaarya; Language. Linguistics. Literature, 1940, chaukhamba sanskrit series office, benares, 601 pages. Barcode 5010010025862   Scan not available.

1157. Dhvanyaalokasaara  shriipurushhottamasharma chaturveda; Language. Linguistics. Literature, 1954, chaukhambhaa san'skrxta san'sthaana vaaraand-asii, 114 pages. Barcode 5010010028308   Scan not available.

1158. Dhvanyaalooka  ravisheikhara pan'd'ita badariinaatha sharma; Language. Linguistics. Literature, 1937, Jaya Krishna Das Haridas Gupta , Benares ., 526 pages. Barcode 5010010012646   Scan not available.

1159. Dhwanyalok Rahasyam Prashnouttari  Pandith Sri Shobhit Mishra; Unknown, 1954, Chowkhamba_Sanskrith_Series_Office, 145 pages. Barcode 2020010004906   Scan available.

1160. Dictionary Bengali and Sanskrit explained in English  Sir Graves C Haughton KNT K H; Others, 1833, London J L Cox and Son, 2853 pages. Barcode 2020050089513   Scan available.

1161. Diinaarkaraajakukaarahemalekhamu  mahaakavishriiseqs-apivara; Language. Linguistics. Literature, 1972, motilaala banaarasiidasa, dilli, 214 pages. Barcode 5010010024491   Scan not available.

1162. Diipikaasaahitamuu  Not available; Religion. Theology, 0, Not available, 694 pages. Barcode 5010010018016   Scan not available.

1163. Diipikaasarvasvamuu  kurugan't'i shriiraamashaastri; Language. Linguistics. Literature, 0, Kuruganti Ramakrishna Shastri , Guntur ., 373 pages. Barcode 5010010012645   Scan not available.

1164. Dilkush Untasdi Gayaki Prathama Bhag  pandit feroz phamaji; Unknown, 1934, pandit feroz phamaji, 56 pages. Barcode 2020010004920   Scan available.

1165. Dina Visheshha  Joshii Prahlaadanarahara; Geography. Biography. History, 1950, Pra Na Joshii, 528 pages. Barcode 2030020016375   Scan not available.

1166. Docrichikitsarnava  Khemraj Shri Krishnadas; Unknown, 1872, Shri Venkateshwara Stream Press, 294 pages. Barcode 2020010004952   Scan available.

1167. Dr C Kunhan Raja Presentation Volume  -; Unknown, 1946, The_Adyar_Library, 552 pages. Barcode 2020010004972   Scan available.

1168. Draahmaayand-a Grxhma Suutravrxtti Grantha 74  Gokhale; Religion. Theology, 1914, Aanandaashramamudrand-aalaye, 117 pages. Barcode 2030020016120   Scan not available.

1169. Draahyaayand-agrxhyasuutramu Rudraskandavrxttisahitamu  thakur udayanarayana singh; Language. Linguistics. Literature, 1934, brahma press, etawah, 162 pages. Barcode 5010010024496   Scan not available.

1170. Draahyayaand-agrxhyasuutravrxtti  Ganesha Sastri Ghokle; Language. Linguistics. Literature, 1914, Hari Narayana Apte, Ananda Ashrama Publications, 107 pages. Barcode 5010010029053   Scan not available.

1171. Drahyana Grihya Sutra  Thakur Udaya Narayana Singh; Unknown, 1934, Printed By Pt. Brahmadeva Misra At The Brahma Press Etawah, 166 pages. Barcode 2020010004965   Scan available.

1172. Dravya Gun Vignan Purvardhamu  Vaidy Jadwaji Trikamaji Acharya; Unknown, 1952, Motilal_Banarassi_Das, 182 pages. Barcode 2020010004968   Scan available.

1173. Dravyagund-asan'graha Dravyagund-asan'grahat'iikaaravyakhyaaya Trxtiiyavrxtti  vaidhyamahaamahopaadhyaayashriichakrapaand-idatta; Language. Linguistics. Literature, 1922, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 120 pages. Barcode 5010010025679   Scan not available.

1174. Dura~daivii Mohare  Lelegan'gadhara~ Vinaayaka~; Geography. Biography. History, 1935, Raajaguru Aand-i ghkan'paniija~ presa~, 156 pages. Barcode 2030020016297   Scan not available.

1175. Dura~gaa Pushhpaanj-jali Grantha 22  Ddivedii Dura~ga Prasaada; Religion. Theology, 1950, Raajasthaana Puraatattvaanveshhand-a Mandira, 214 pages. Barcode 2030020016019   Scan not available.

1176. Dutaangadamu  shriisubhat'a; Language. Linguistics. Literature, 1900, Tukaram Javaji,Bombay, 20 pages. Barcode 5010010032843   Scan not available.

1177. Dutadangand  Sr Madananthram Shastry Vetalen; Unknown, 1950, CHOWKHAMBA SANSKRIT SERIES OFFICE, 86 pages. Barcode 2020010004990   Scan available.

1178. duutaad'gadam  pand-ita durgaaprasaadena; Literature, 1891, Nirnayasagar Press , Mumbai, 456 pages. Barcode 5010010091959   Scan available.

1179. Dvadasaranaya Chakra Of Sri Mallavadisuri Vol 1  Late Munichaturvijayaji; Unknown, 1952, Oriental_Institute, 388 pages. Barcode 2020010004991   Scan available.

1180. dvadashaaran' nayachakramu  Munichaturvijay Pandit lalchandrsrva Bhagavan Sresthitanuj; , 1906, The Maharaja Sayajirao University of Baroda, 380 pages. Barcode 5010010006856   Scan not available.

1181. Dvadashan' Pushhpama~  Shriivasudevaanan'da~; Religion. Theology, 1954, Samara~tha Bhaarata~ Chhaapakhaanaa, 674 pages. Barcode 2030020016274   Scan not available.

1182. dvaitanir^nd-ayasiddhaantasam'graha  Bhanu Bhatta; SOCIAL SCIENCES, 1937, Govt. Of Allahabad, 262 pages. Barcode 5010010030622   Server error, availability unknown.

1183. dvatadhumand-in  Hulagi Sripathyacharya; Religion, 1950, Satyadhyana VidhyaPeettam, 516 pages. Barcode 5010010000740   Server error, availability unknown.

1184. dvatasiddaantasaaran  S.r.raghuthamacharya; Literature, 1983, Sri Ranganathacharya Mysore, 120 pages. Barcode 5010010004848   Server error, availability unknown.

1185. Dvijakanyaanamu Vivaahakaalivimarsha  ti ve shriinivaasaashaastrind-aa; Language. Linguistics. Literature, 1912, chennapuuryaamu aanandamudraashaala, 168 pages. Barcode 5010010025996   Scan not available.

1186. Dvisan'dhaanamu  badarinaada; Language. Linguistics. Literature, 1895, Tukaram Javaji, Bombay, 232 pages. Barcode 5010010032849   Scan not available.

Return to the top

E


1187. Eclipse Cult In Veda's Bible And Koran  shyamasastry r; Language. Linguistics. Literature, 1940, mysore, 240 pages. Barcode 2020050058024   Scan not available.

1188. Educationas A School Social Factor  M L Jacks; Unknown, 1937, Kagan_Paul_Treanch_Trubner_Co., 212 pages. Barcode 2020010011373   Server error, availability unknown.

1189. Eeshavasya Upanishad I- V I I I  Srimath Paramhans Parivrajakar Chary Brahmanisht Loksangrahi; Unknown, 999, Navahind_Publications, 534 pages. Barcode 2020010005029   Scan available.

1190. Eeshopanishanthu  -; Unknown, 999, -, 490 pages. Barcode 2020010005030   Scan available.

1191. Eethi Sriskande Mahapuranam Prabhaskhand  mahadeva deshiah; Unknown, 999, Steem_Mudranalay, 670 pages. Barcode 2020010005033   Scan available.

1192. eitareya braamhand-aa  Shadguru; Religion, 1942, T.T.D Tirupati, 240 pages. Barcode 5010010006525   Scan not available.

1193. eitareya braamhand-aa  Anantakrishna Sastri; Religion, 1942, UNIVERSITY OF TRAVANCORE SANSKRIT SERIES ,TRIVANDRUM, 666 pages. Barcode 5010010006526   Scan not available.

1194. eitareya taamaraaparinayamu  T.r.krishnacharya; Religion, 1908, T.R.Krishnacharya,Kumbhakonam, 452 pages. Barcode 5010010000242   Server error, availability unknown.

1195. eitareyaarand-yakamu  Aurobindo; Sri Aurobino, 1944, Arya Publishing House, Calcutta, 298 pages. Barcode 5010010006904   Scan not available.

1196. eitareyabraamhaand-amuu  hari naaraayand-a aapat'e; Religion, 1828, , 550 pages. Barcode 5010010087222   Scan not available.

1197. eitareyabraamhaand-amuu2  hari naaraayand-a aapat'e; Religion, 1818, Ananda Press, 496 pages. Barcode 5010010087231   Scan not available.

1198. eka ugate raashht'ra kaa maasika  shriipataraaya; LANGUAGE. LINGUISTICS. LITERATURE, 1938, Not available, 190 pages. Barcode 5010010026723   Server error, availability unknown.

1199. Ekaagnikaand-d'a  shriinivaasachaarya; RELIGION. THEOLOGY, 1902, The Government Branch Press , Mysore, 240 pages. Barcode 5010010042522   Scan not available.

1200. Ekavali Of Vidhydahra  Dr P Sriram Chandrudu; Unknown, 1981, DEPARTMENT OF SANSKRIT OSMANIA UNIVERSITY, 418 pages. Barcode 2020010005040   Scan available.

1201. Ekaviiraa  kavisaamraat'u vishvanaatha satyaanaaraayand-a; Language. Linguistics. Literature, 0, Not available, 108 pages. Barcode 5010010024501   Scan not available.

1202. Elements Of Hindu Culture And Sanskrit Civilization  Acharaya Prasanna Kumar; GEOGRAPHY. BIOGRAPHY. HISTORY, 1939, Gopi Lal Dikshit, 199 pages. Barcode 8000000004085   Scan not available.

1203. English Sanskrit Dictionary  no; Others, 1800, no, 527 pages. Barcode 2020050089523   Scan available.

1204. Epika Bhavaarth Bodhini  Pandith Gopeshkumar; Unknown, 1969, MOTI LAL BANARSIDAS, 680 pages. Barcode 2020010006790   Scan available.

1205. Esevyopanishad Bhashyam  Veeraragava Achariya; Unknown, 1933, The Srinivasa Press ,Tiruvadi, 177 pages. Barcode 5010010000776   Scan not available.

1206. etareyaarand-yakamuu  naaraayand-a aapat'e; Religion, 1820, Ananda Press, 302 pages. Barcode 5010010087203   Scan not available.

1207. etareyoopanishhatsat'iika  ; Religion, 1877, , 112 pages. Barcode 5010010087196   Scan not available.

1208. Exercises In Sanskrit Translation  T.k ramachandra aiyar; Religion. Theology, 2004, R.S vadhyar and sons, 116 pages. Barcode 2020050017243   Scan available.

Return to the top

F


1209. First Lesson In Sanskrit  Dr.j.r.ballantyne; Unknown, 1968, CHOWKHAMBA VIDYABHAWAN, 100 pages. Barcode 2020010011499   Server error, availability unknown.

Return to the top

G


1210. gaadaadharii  M.m.vindhyeswari Prasada Dvivedi; Art, 1970, Chowkhamba Sanskrit Series Office Varanasi, 770 pages. Barcode 5010010004931   Server error, availability unknown.

1211. Gaadaadharii Tattvachintaamand-yaa Diidhityaa Cha Garbhitaa  shriigadaadharabhat't'aachaaryachakravartti; Language. Linguistics. Literature, 0, Not available, 766 pages. Barcode 5010010025997   Scan not available.

1212. Gaadadhari Vol Ii  -; Unknown, 1801, Choukambha_Publications, 1084 pages. Barcode 2020010005091   Scan available.

1213. gaan'dhii giitaa  jooshii; Religion, 1523, Anand Press, Mumbai, 42 pages. Barcode 5010010087221   Scan not available.

1214. gaathaasaptashaatii  B.mathuranath Shastri; Religion, 1998, Motilal Banarsidass Delhi, 446 pages. Barcode 5010010004939   Server error, availability unknown.

1215. gaathaashaptashaatii  Sathavahana; Religion, 1911, Tukaram_Jevaji_Mumbai, 228 pages. Barcode 5010010004940   Server error, availability unknown.

1216. Gaayatriivyaakhayaa  Sritaranath; Language. Linguistics. Literature, 1875, Upadidarinaa, 82 pages. Barcode 5010010029788   Scan not available.

1217. Gadaadhaarii  yam.yam.pi vandeishvari; Language. Linguistics. Literature, 1927, Vidya Vilas Press, Benares, 554 pages. Barcode 5010010025998   Scan not available.

1218. Gadaadharapadvatau Aachaarasaara  Gadadhara Rajaguru; Social Sciences, 1908, Asiatic Society Of Bengal, 522 pages. Barcode 5010010030624   Scan not available.

1219. gadhatrayamuu  Sri Mad Ramanuja; Philosophy. Psychology, 1910, R. Krishnamacharya, Srirangam, 134 pages. Barcode 5010010026479   Scan not available.

1220. Gadhy Padhy Mala Chaturth Kusumam Vol I  -; Unknown, 999, AKSHAR MUDRANALAY, 152 pages. Barcode 2020010005101   Scan available.

1221. Gadya Bhaaratii  omaprakaasha; Language. Linguistics. Literature, 1978, esa chanda end-d'a kampanii li, 149 pages. Barcode 5010010012722   Scan not available.

1222. Gadya Bhaaratii  omaprakaasha; Language. Linguistics. Literature, 1978, esa chanda end-d'a kampanii li, 149 pages. Barcode 5010010012363   Scan not available.

1223. gadyachin'taamand-i  kuppuswaami shaastri; Literature, 1902, Not available, 184 pages. Barcode 5010010091968   Scan not available.

1224. gadyachin'taamand-i  kuppuswaami shaastrii; Literature, 1902, Not available, 185 pages. Barcode 5010010092111   Scan available.

1225. Gadyachintaamand-i  t s kuppuswami sastri and s subrahmanya sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1902, G A Natesan And Co,Esplanade Row,Madras, 190 pages. Barcode 5010010078781   Scan available.

1226. Gaekwad's Oriental Series  Bhattacharya; Unknown, 1987, BHATTACHARYA,BARODA, 140 pages. Barcode 5010010000817   Scan not available.

1227. Gaja Saastram Of Paalakapya Muni  subrahmanya sastri k s; Language. Linguistics. Literature, 1958, s gopalan, 470 pages. Barcode 2020050058015   Scan not available.

1228. Gajagrahana Prakasa  Narayana Dikshita; Unknown, 1968, Sri_Venkateswara_University, 106 pages. Barcode 2020010005104   Scan available.

1229. Gajasiksa  Sree Krishna Sarma E.r; Unknown, 1975, S.V.U. Oriental Research Institute Tirupati, 96 pages. Barcode 5010010000821   Scan not available.

1230. Gajasiksa  E.r.sreekrishna sarma; Unknown, 1975, S.V.U. Oriental Research Institute Tirupati, 96 pages. Barcode 5010010000822   Scan not available.

1231. Gajasiksha  naradamuni; Unknown, 1975, venkateswara university oriental research insitute, 94 pages. Barcode 2020010005107   Scan available.

1232. Gananeshwari  Krishana Gi Parisharam Bide; Unknown, 999, Sri_Nanamaharaj_Joshi_Sakrai, 561 pages. Barcode 2020010005112   Scan available.

1233. Ganatiya Kosh  Dr.brej Mohan; Unknown, 1954, Chaukhamba Sanaskrit Series, 702 pages. Barcode 2020010005114   Scan available.

1234. Gand-adara~pand-a Shhashht'ha San'skarand-ama~  Raamataarand-a; Language. Linguistics. Literature, 1920, Kalikaataaraajadhaanyaan', 253 pages. Barcode 2030020016093   Scan not available.

1235. Gand-akaarikaa  c. d. dalal; Language. Linguistics. Literature, 1920, central library, baroda, 72 pages. Barcode 5010010024506   Scan not available.

1236. Gand-akaarikaa  Bhasara~vajnaa Aacharaya~; Language. Linguistics. Literature, 1920, Da Gujaraati Print'in'ga~ Presa~, 78 pages. Barcode 2030020016317   Scan not available.

1237. Gand-ikaa Vrxtta San'grah Khand-d'a 1 Grantha Maalaa 4  Sternbach Ludwik; Social Sciences, 1953, Vishveshvaraananda San'sthaana, 206 pages. Barcode 2030020016097   Scan not available.

1238. Gand-itaadhyaaya Vyaakhyaaya Samanvita  mitaddara; Language. Linguistics. Literature, 1915, kalikaataamahaanagaryyamu vaachaspatyayantre, 276 pages. Barcode 5010010024579   Scan not available.

1239. Gandavyuhasutra  P L Vaidya; Unknown, 1960, The_Mithila_Insitute, 490 pages. Barcode 2020010005115   Scan available.

1240. Gandhi Gita  S.n.tadpatrikar; Unknown, 1949, Oriental_Book_Agency, 130 pages. Barcode 2020010005123   Scan available.

1241. Ganesa Purana  Unknown; Religion. Theology, 999, Unknown, 348 pages. Barcode 5010010010801   Scan not available.

1242. Ganesh  Sampurnanand; Unknown, 2001, Kashi_Vidhya_Peeth, 90 pages. Barcode 2020010005135   Scan available.

1243. Ganesh Siddi  -; Religion. Theology, 0, -, 458 pages. Barcode 2020050036069   Scan not available.

1244. Gangavaratana  Pandit Kedaranatha Sastri; Unknown, 1916, Tukaram_Javaji, 82 pages. Barcode 2020010005137   Scan available.

1245. Ganitatilaka  Sripati; Unknown, 1937, Oriental_Institute, 214 pages. Barcode 2020010005138   Scan available.

1246. Garuda Maha Puranam Of Sri Vedavyasa Mahamuni  P.padmanabhachrya Chitaguppa; Unknown, 2000, Vishva_Madhva_Maha_Pratishthanam,Bangalore, 226 pages. Barcode 5010010000827   Scan not available.

1247. Garuda Puranam  Somraj Krishna Das; Unknown, 1867, Sri Venkateshwara Steam Press, Mumbai, 542 pages. Barcode 5010010010800   Scan not available.

1248. Gatagoshha~t'i Arathata~ Maajhii Jiivana Yaatraa  Kelakara Chin' Na; Geography. Biography. History, 1939, Kesarii Presa~ Puune, 707 pages. Barcode 2030020016517   Scan not available.

1249. Gathaa Bhrxgvajirasaatmakasya Atharvavedasya Upasthaanaamake Bhrxgukhand-d'e  jotindra mohan chatterjee; Language. Linguistics. Literature, 1932, cherag office, navsari, 432 pages. Barcode 5010010025999   Scan not available.

1250. Gaud'apaadoyama~ Aagamashaastrama~  Gaud'ayaada; Philosophy. Psychology, 1950, Met'a~ro Paalit'ana End-d'a Pablishing-ga Hausa limit'ed'a~, 360 pages. Barcode 2030020016506   Scan not available.

1251. Gautamaprand-iita Dharmasuutraand-ii  chimand-aajii aapt'e; Language. Linguistics. Literature, 1881, Ananda Sama Mudranalaya, 262 pages. Barcode 5010010026001   Scan not available.

1252. Gautamiyamahatantram  Dr.ramaji Malaviya; Tantras, 1992, Sampurnananda_Sanskrit__University_Varanasi, 383 pages. Barcode 5010010000829   Scan not available.

1253. Geeta Vignana - Bhashya  Sharma.m.l; , 1939, Sri Bala Chandra Llakutra,Jaipur, 383 pages. Barcode 5010010006939   Scan not available.

1254. Geetageervanam  S B Valankar; Unknown, 1972, Sanskrit_Books, 100 pages. Barcode 2020010005142   Scan available.

1255. Geetha Dharm Chandogyaupanishad Vol Ii  Sri Math Paramhans Parivrajakarchary Brahmanisht Lok Sangrahi; Unknown, 999, Navahind_Publications, 532 pages. Barcode 2020010005148   Scan available.

1256. Geetharthsangraharsha Geetabhashytathparyachandrikach  A.sampath Kumara Charya; Unknown, 1941, THe_Liberty_Press, 890 pages. Barcode 2020010011575   Server error, availability unknown.

1257. Geethopadesa  Anil Varan Roy; Unknown, 1948, Sri Geetha Samithi,Kasi, 219 pages. Barcode 5010010000836   Scan not available.

1258. Giita Goovinda Aur Abhinaya  K Vasudeva Sastri; Language. Linguistics. Literature, 1950, S . Gopalan , Tanjore ., 190 pages. Barcode 5010010012644   Scan not available.

1259. Giita Govinda Rasikapriya Rasamanjari  jayadeva; Language. Linguistics. Literature, 1929, nirnayasagar press, bombay, 202 pages. Barcode 5010010025680   Scan not available.

1260. Giitaagn-aana Prathama Adhyaaya Arjuna Kaa Vishhaada  pan' diinaanaatha bhaargava dinesha; Language. Linguistics. Literature, 0, maanavadharma kaaryaalaya dililii, 814 pages. Barcode 5010010028309   Scan not available.

1261. Giitaapadmavikaasa  ma daa khare; Language. Linguistics. Literature, 1892, Not available, 390 pages. Barcode 5010010026002   Scan not available.

1262. giitaasamiqs-aa  K.s. Ramamurthi; Bhagavadgita, 1971, SRI VENKATESWARA UNIVERSITY, 188 pages. Barcode 5010010006957   Scan not available.

1263. Giitaasandesha  svaamii raamadaasajii kahaaraaja; Language. Linguistics. Literature, 0, aanandaashrama kaanhaang-gada, 170 pages. Barcode 5010010026003   Scan not available.

1264. Giitaashaastraarthaviveka  Not available; Language. Linguistics. Literature, 0, adhyatma prakaasha karyaalaya, 228 pages. Barcode 5010010018017   Scan not available.

1265. giitaataatparyanirnd-ayapraaran'bha'  ; Religion, 1921, , 23 pages. Barcode 5010010087237   Scan not available.

1266. Giitaayogapradipaara~yyabhaashhya  Aara~muni Pand-d'ita~; Religion. Theology, 1924, Hitachintaka Yantraalaya Raamaghat'a Kaashii, 507 pages. Barcode 2030020016287   Scan not available.

1267. giitopadesha  Anil Varan Roy; Religion, 1948, Sri_Gits_Samiti_Kasi, 219 pages. Barcode 5010010004943   Server error, availability unknown.

1268. Gilgit Manuscripts Vol I  Dr.nalinaksha Dutt; Religion, 1939, SREENAGAR KASHMIER, 174 pages. Barcode 5010010000849   Scan not available.

1269. Gilgit Manuscripts Vol I I I Part I I I  Dr Nalinaksha Dutt; Unknown, 1943, MR J C SARKHEL THE CALCUTTA ORIENTAL PRESS, 178 pages. Barcode 2020010005170   Scan available.

1270. Gilgit Manuscripts Vol Ii  Nalinaksha Dutt; Religion, 1941, SREENAGAR KASHMIER, 247 pages. Barcode 5010010000848   Scan not available.

1271. Gilgit Manuscripts Vol Iii  Dr Nalinaksha Dutt; Unknown, 1942, MR J C SARKHEL THE CALCUTTA ORIENTAL PRESS, 256 pages. Barcode 2020010005171   Scan available.

1272. Gilgit Manuscripts Vol Iii Part 3  Nalinaksha Dutt; Religion, 1943, The calcutta Oriental Press,Calcutta, 184 pages. Barcode 5010010000847   Scan not available.

1273. Gilgit Manuscripts Vol Iii Part Ii  Nalinaksha Dutt; Religion, 1942, The calcutta Oriental Press,Calcutta, 253 pages. Barcode 5010010000846   Scan not available.

1274. Gita Samiksa  E R Sreekrishna Sarma; Unknown, 1971, Sri_Venkateshwara_University, 186 pages. Barcode 2020010005180   Scan available.

1275. Gitagovinda Kavyam  Narayana Ram Acharya; Unknown, 999, Satyabhamabai_Pandurang, 246 pages. Barcode 2020010005176   Scan available.

1276. Gitagovinda Mahakavyam  jayadeva; Language. Linguistics. Literature, 1969, the sanskrit academy hyderabad, 422 pages. Barcode 2020050036083   Scan not available.

1277. Gitagovinda Mahakavyam  Dr.aryendra Sharma; Unknown, 1969, Sanskrit_Academy, 360 pages. Barcode 2020010005177   Scan available.

1278. Gitagovinda Of Jayadeva  K.s. Ramamurthi; Religion, 1990, S.V.U. Oriental Research Institute Tirupati, 322 pages. Barcode 5010010000851   Scan not available.

1279. Gitagovinda Of Jayadeva With Commentary Of Laksmidara  k s ramamurty; Unknown, 1990, oriental research insitute, 322 pages. Barcode 2020010005178   Scan available.

1280. Glimpses Of Buddhist Culture In India  V Subramaniam; Unknown, 1983, Ashish_Publishing_House, 132 pages. Barcode 2020010005184   Scan available.

1281. Gn-aanadiipikaa Mahaabhaarata Bhiishhmaparva  shriidevaboodha; Language. Linguistics. Literature, 1947, bhandarkar oriental research institute poona, 43 pages. Barcode 5010010018030   Scan not available.

1282. Gobhilagrxhyasuutran  Sri Mukunda Jha Bakshi; Language. Linguistics. Literature, 1936, Jaya Krishnadas Haridas Gupta, Benares, 352 pages. Barcode 5010010029030   Scan not available.

1283. Gobhiliiyagrxhyasuutramuu  chintaamaand-i bhat't'aa; LANGUAGE. LINGUISTICS. LITERATURE, 1936, Metropolitan Printing And Publsihing House , Calcutta, 662 pages. Barcode 5010010042534   Scan not available.

1284. Gochar Aur Asthakavarga  Aacharya baskaranand lohini; Religion. Theology, 999, Agrahayanaprakasana luknow, 116 pages. Barcode 2020050017189   Scan available.

1285. Golaadhyaaya Uttarara~dharupo Da~tiiyo Bhaaga  Bhaaskaraachara~yaa Shrii; Religion. Theology, 1952, Aanandaashramamudrand-aalayan', 316 pages. Barcode 2030020016410   Scan not available.

1286. goladiipikaa  ta. gand-apatishaastrind-aa; Literature, 1916, Re Published, Chennai, 46 pages. Barcode 5010010092021   Scan available.

1287. Goladyay Dwithiya Bagam  Gangadar Bapurao Kale; Unknown, 1952, Anandasram_Mudranalay, 320 pages. Barcode 2020010005188   Scan available.

1288. Goldavyaprashnavimarsh  Dattatrey Venkateshwar Kettar; Unknown, 1934, Arya_Bhushan_Press, 100 pages. Barcode 2020010005190   Scan available.

1289. Gomileeygruhakarmaprakashika  Subhramanyamvidhusha; Unknown, 1932, Navahind Publications, 512 pages. Barcode 2020010005192   Scan available.

1290. Gommatasara Karma Kandah  Mohan Lal; Unknown, 1927, Swweshankar_Jag_Jeevan_Jowari, 338 pages. Barcode 2020010005193   Scan available.

1291. Goobhila Graahya Suutra  M.m. Marunda; Language. Linguistics. Literature, 1936, aashama Mudranalaya, 330 pages. Barcode 5010010028310   Scan not available.

1292. Goomiliiyaguhakarmaprakaashikaa  subrahand-ya vidushha; Language. Linguistics. Literature, 1986, Not Available, 514 pages. Barcode 5010010028311   Scan not available.

1293. Goopikoonmaada  shuuranaad'uu krxnjanuu pilla; Language. Linguistics. Literature, 1956, University Manuscripts Library , Trivandrum ., 34 pages. Barcode 5010010012643   Scan not available.

1294. Gootaavalii Sat'iik  gopeenauth pathuk; Language. Linguistics. Literature, 1869, the light press, 288 pages. Barcode 5010010012570   Scan not available.

1295. Gopala Sahasranama Stotram  Dr.n.s.r.tatacharya; Unknown, 1985, T.T.D Tirupati, 126 pages. Barcode 2020010005198   Scan available.

1296. Gopath Brahmana Of Atharva Veda  Rajendra lal Mithra; Unknown, 1972, Indological Book House, 244 pages. Barcode 2020010011622   Server error, availability unknown.

1297. gopurasandesaa  Srinivasacharyulu, Bommakanti; Literature, 1995, Kalyani Prachuranalu,Hyderabad, 57 pages. Barcode 5010010006964   Scan not available.

1298. Graganithadyaya  -; Unknown, 1941, Anandha Shamudralaya, 186 pages. Barcode 2020010005209   Scan available.

1299. Grahalaadhavan' Karand-amu T'iikaa  gand-eshadaivagn-aani; Language. Linguistics. Literature, 1846, shriiveng-kat'eshvara st'iimu mudrand-aayantraalaya, mun'bayya, 384 pages. Barcode 5010010025696   Scan not available.

1300. Gramaand-avaatikabhaashhyamu Pradhama Puraand-amu  Tripitakacharya Mahapandita; Language. Linguistics. Literature, 1955, Kashiprasad Jayaswal Research Institute , Patna ., 62 pages. Barcode 5010010012640   Scan not available.

1301. Gramegeya Ganamatk  Narayan; Unknown, 999, Vikramiya_Samvanth, 452 pages. Barcode 2020010011636   Server error, availability unknown.

1302. Grantharatnamaalaa  Not Available; Language. Linguistics. Literature, 0, Not Available, 45 pages. Barcode 5010010012368   Scan not available.

1303. Grihya Sutras Of Varah  Krishna Yajurved; Unknown, 1934, SHASTRA PUBLISHING HOUSE., 66 pages. Barcode 2020010005226   Scan available.

1304. Gruha Vidhan  veerendrarai chandra shankar mehatha; Unknown, 1946, veerendrarai chandra shankar mehatha, 338 pages. Barcode 2020010005236   Scan available.

1305. gruhaasutra san'graha  Sri Rama Sharmacharya; Art, 1972, Samskruti Samsthan Bareli, 504 pages. Barcode 5010010004979   Server error, availability unknown.

1306. Grxhyasuutramu Grxhyaparishishht'amu Grxhyakaarikaashcha  bhat't'akumaarilasvaami; Religion. Theology, 1815, nirnd-ayasaagaraakhyamudraalaya mumbayyaan', 374 pages. Barcode 5010010024516   Scan not available.

1307. Gudhartha Dipika  Dhanapati Suri; Unknown, 1908, Harikrishna Dasa Benares, 284 pages. Barcode 5010010000865   Scan not available.

1308. Gudharthatattvaloka A Commemtary On Samanyanirukti Gadadiiari  Pandit S'ri Lakshminatha Tha; Unknown, 1935, Jai_Krishna_Das_Haridas_Gupta, 200 pages. Barcode 2020010005238   Scan available.

1309. guhyasamaajatantamuu  Benoytosh Bhattacharyya; Religion. Theology, 1931, Oriental Insritute, Baroda,, 266 pages. Barcode 5010010026478   Scan not available.

1310. Guptapaashupatamu Amrxtasharmishht'hamu  kavisamraat'a vishvanaatha satyanaaraayand-a; Language. Linguistics. Literature, 0, Not available, 182 pages. Barcode 5010010024522   Scan not available.

1311. Guruparampara Charita With Comm  Unknown; Religion. Theology, 1964, Unknown, 1049 pages. Barcode 5010010010795   Scan not available.

1312. Gurushushruubaa San'vargavidhyopadeshashcha  Not available; Language. Linguistics. Literature, 0, Not available, 38 pages. Barcode 5010010024524   Scan not available.

1313. Guruvamsha Mahakavyam  Krishnamacharya; Unknown, 999, -, 153 pages. Barcode 2020010005253   Scan available.

1314. Gurvarthadipika  Sri vadiraja Tirtha; Unknown, 1952, Srimadvadirajiya_Granthaprakashana_Samiti, 249 pages. Barcode 5010010000869   Scan not available.

1315. Guurvaarthadiipikaa Dvitiiya Pushhpamuu  shriimadaanandatiirthabhaagavatpaadaachaarya; Language. Linguistics. Literature, 1952, Not available, 256 pages. Barcode 5010010017953   Scan not available.

1316. Guurvarthadiipikaa Prathamaadhyaaya  Not available; Language. Linguistics. Literature, 0, Not available, 186 pages. Barcode 5010010017738   Scan not available.

1317. Gyaariibaald'ii  Kelakara Narasin'hachin'taamand-a; The Arts, 1945, Mahaarashht'ra Mudrand-ashaalaa Presa~, 167 pages. Barcode 2030020016456   Scan not available.

Return to the top

H


1318. h Kalpmudram  Shambhusinghji Suthaliyadheeshkruth; Unknown, 999, KHEMRAJ SRI KRISHNA DAS PRAKASHAN, 226 pages. Barcode 2020010005540   Scan available.

1319. Haaralataa  Aniruddha Bhatta; Social Sciences, 1909, Asiatic Society Of Bengal, 257 pages. Barcode 5010010030657   Scan not available.

1320. Haasyaara~nd-avaprahasanama~  Shriijagadiishhvarabhat't'aachaara~ya; Philosophy. Psychology, 1896, Daamodara San'valaaraama Aand-i Man'd'alii, 115 pages. Barcode 2030020016384   Scan not available.

1321. Haimsa Phrama~ Da Rxgvedaa  Piit'ara~sana~ Piit'ara~; Religion. Theology, 1917, Da Gavara~nament'a~ Sent'a~rala~ Presa~, 383 pages. Barcode 2030020016526   Scan not available.

1322. Halayudh Kosha  Jaya Shankar Joshi; Unknown, 999, PRAKASHAN BURO, 764 pages. Barcode 2020010005265   Scan available.

1323. Halayudhkosh Abhidhanratnamala  Jai Shankar Joshi; Unknown, 1879, Sarawathi_Bhavan, 763 pages. Barcode 2020010005264   Scan available.

1324. Hamaarii Sroudim Jaatiyaan'  bhagavaandaas keilaa; PHILOSOPHY. PSYCHOLOGY, 9999, bhaaratiiya grnathamaalaa ,daaraagn'ja, ilaahaabaad, 392 pages. Barcode 5010010078326   Scan available.

1325. han'sasan'desha  vedaantaachaarye; Literature, 1912, Not available, 666 pages. Barcode 5010010092178   Scan available.

1326. Han'sasan'desha  Not available; Language. Linguistics. Literature, 0, Not available, 140 pages. Barcode 5010010028177   Scan not available.

1327. Hanumada Rahasyamu Hindiivyaakhyaaya Vibhuushhitamu Hanumatpuujaapaddhati  aachaarya pand-d'ita shriishivadattamishrashaastrii; Religion. Theology, 0, Not available, 336 pages. Barcode 5010010025700   Scan not available.

1328. Hanumanatakam  shrii manimshradaamodarene; Language. Linguistics. Literature, 1946, vaibhav mudralayam bombay, 218 pages. Barcode 2020050036044   Scan not available.

1329. Hanumannaat'akamuu  shriikrxshhnd-adaasaa; Language. Linguistics. Literature, 1822, laqs-miivenkat'esvara mudrand-aa, 262 pages. Barcode 5010010012496   Scan not available.

1330. Hanumannnatak  Ram Swaroop Sharma; Unknown, 1958, LAXMI VENKATESHWAR STEEM PRESS, 238 pages. Barcode 2020010005272   Scan available.

1331. Hara Naaraayand-a Aapat'e Yaan'chen' San'qsipta Charitra  Aan'bekara baapujiimaara~tan'd'a; Geography. Biography. History, 1922, Aara~ya Bhuushhnd-a Chhapakhaana, 139 pages. Barcode 2030020016459   Scan not available.

1332. harameikhalaa maahukaviracchitaa sat'ikaa  K.samba Shiva Sastri; Philosophy. Psychology, 1938, Maharaja Of Thanjavur, 108 pages. Barcode 5010010026477   Scan not available.

1333. Haravijayam Of Rajanaka Ratnakara  Durgaprasada amp Kasinath Pandurang Parab; Religion, 1982, Chaukhamba_sanskrit_Sansthan, 743 pages. Barcode 5010010000878   Scan not available.

1334. Hari Charitra  Parameswara Bhatta; Unknown, 1948, The_Adyar_Library, 146 pages. Barcode 2020010005276   Scan available.

1335. Hari Naaraayand-a Aapat'e Charitra Va Vaang-a~mayavivechana  Paanase Venubaaii; The Arts, 1931, Bolodhyaana Presa~, 419 pages. Barcode 2030020016491   Scan not available.

1336. Haribhadra Suri Grantha Sangrahah  Gulab Chand; Unknown, 1939, Sri Jain Grandha Prakasika, Ahmedabad, 261 pages. Barcode 5010010010794   Scan not available.

1337. Haricarita By Paramesvara Batta  Paramesvara Bhatta; Literature, 1948, The Adyar Libeary,Madras, 144 pages. Barcode 5010010006981   Scan not available.

1338. Haricharita  O.y.sri.dhorasamaiah; Religion, 1948, THE ADAYAR LIBRARY, 0 pages. Barcode 5010010000880   Scan not available.

1339. Haricharita  Durgaprasada amp Kasinath Pandurang Parab; Religion, 1948, THE ADAYAR LIBRARY,  pages. Barcode 5010010002659   Scan not available.

1340. Haricharita  Jaya Bharati,m.k; Literature, 1948, THE ADAYAR LIBRARY, 0 pages. Barcode 5010010006980   Scan not available.

1341. haridiiqs-itakrutaa brahaasuutravt'anti  Hari Narayan Apte; Philosophy. Psychology, 1917, Anandha Ashrama Publications, 246 pages. Barcode 5010010026476   Scan not available.

1342. Haridiiqs-itakrxtaa Brahmasutravrxtti  Haridiiqs-ita; Philosophy. Psychology, 1917, Aanandaashramamudrand-aalayan', 254 pages. Barcode 2030020016244   Scan not available.

1343. haridiqs-atakrutaa buhaasutravutin  Hari Narayana Apte; Religion. Theology, 1934, Ananda Ashrama Sanskruta Grandavali Bangalore, 249 pages. Barcode 5010010000886   Server error, availability unknown.

1344. Hariharaaddaitabhuushhand-ama~  Bodhendrasarasvati; Religion. Theology, 1954, Madras Govt, 199 pages. Barcode 2030020016012   Scan not available.

1345. hariharaadotabhushhand-amu  Bodhendrasarasvati; Linguistics Literature, 1954, Government Oriental Manuscripts Library, Madras, 197 pages. Barcode 5010010004994   Server error, availability unknown.

1346. Hariharaadvatabhushhand-amu  bodhendrasarasvati; Language. Linguistics. Literature, 1954, The Superindent Of Government Printing Press , Chennai ., 196 pages. Barcode 5010010012642   Scan not available.

1347. Hariharachaturang-gamuu  goodaavaramishra; Language. Linguistics. Literature, 1950, government oriental manuscripts library madras, 268 pages. Barcode 5010010018018   Scan not available.

1348. Hariharadvaita Bhusanam With Karika  bodhendrasarasvati; Language. Linguistics. Literature, 1954, government oriental manuscripts library madras, 198 pages. Barcode 2020050057985   Scan not available.

1349. hariharasubhaashhitam  vaasudevasharmand-a; Literature, 1910, Nirnayasagar Press , Mumbai, 70 pages. Barcode 5010010092052   Scan available.

1350. hariharasubhaashhitama  Not available; Literature, 1896, Not available, 70 pages. Barcode 5010010092142   Scan available.

1351. Harikavi Alias Bhanubhatta  gode p k; Language. Linguistics. Literature, 0, -, 38 pages. Barcode 2020050057997   Scan not available.

1352. Hariliilaa Nan' 3  Vopadeva; Religion. Theology, 1920, San'skrxtayantra Pustakaalaya 30 Kara~nd-aoyaaliisa~ Print'a~, 120 pages. Barcode 2030020016480   Scan not available.

1353. Harishchandra Naat'akamuu  Not Available; LANGUAGE. LINGUISTICS. LITERATURE, 9999, tapovan vighaapiit'ha prakaashan vaaraasivanii, 58 pages. Barcode 5010010078704   Scan available.

1354. Harishrchandropaakhyaanama~  R. Sudarsana Sarma And Sahitya Siromani; Language. Linguistics. Literature, 1935, R. Sudarsana Sarma And Sahitya Siromani, 112 pages. Barcode 5010010032292   Scan not available.

1355. Harisowbhaagyamu  shriidevimalagand-i; Language. Linguistics. Literature, 1900, Tukaram Javaji,Bombay, 941 pages. Barcode 5010010032858   Scan not available.

1356. Harivaasamu  Unknown; Religion. Theology, 1956, Unknown, 900 pages. Barcode 5010010010793   Scan not available.

1357. harivam'shaatar^gatam' trxtiiyam' bhavishhyapar^va (Manuscript)  Jagannatha Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1904, Sri Hariprasad, 300 pages. Barcode 5010010032522   Server error, availability unknown.

1358. Harivamsa  parushuram lakshman vaidya; Language. Linguistics. Literature, 1971, bhandarkar oriental research institute poona, 934 pages. Barcode 2020050036059   Scan not available.

1359. Harivan'shaachii Bakhara  Vaamanashaastriikhare Vasudeva; Geography. Biography. History, 1909, Aara~yabhushana~ Chhaapakhana, 113 pages. Barcode 2030020016372   Scan not available.

1360. Harmakutam Sundarakanda  Tryambaka Makhin; Unknown, 1951, Tmss_Mahal_Library, 556 pages. Barcode 2020010005286   Scan available.

1361. Harsha Charitam  Bal Govind Jha; Unknown, 1994, Krishana_Academy, 590 pages. Barcode 2020010011677   Server error, availability unknown.

1362. Harshacharita Ek Samskrutika Adhyayana  Vasudevasaran Agarwal; Literature, 1964, Bihar Rastra Basha Parishad, Patna, 305 pages. Barcode 2020010021794   Scan available.

1363. Harshacharita Sara  Pandit V Ananthachary; Unknown, 1655, RAM NARAIN LAL, 67 pages. Barcode 2020010005287   Scan available.

1364. Harshacharita The Fifth Ucchhvasa  C Sankara Rama Sastri; Unknown, 1957, The_Sri_Balamanorama_Press, 166 pages. Barcode 2020010005288   Scan not available.

1365. Harshacharitha Sangraha  Mahadevaiah K.p; Religion. Theology, 1850, SRI BAALAMANORAMAAKUDRAYATHRALAYA, 93 pages. Barcode 5010010000888   Scan not available.

1366. Harshacharitha Sangraha  R.v Krishnamachariar; Religion. Theology, 1999, -, 104 pages. Barcode 2020050017241   Scan available.

1367. Harshcharitamu  bhanabatta; Language. Linguistics. Literature, 1946, narayan ram acharya bombay, 272 pages. Barcode 2020050057967   Scan not available.

1368. harshhacharitama  mahaakavivaaraabhat'aaprashiitama; Religion, 1883, Sanskrit Press, Calcutta, 242 pages. Barcode 5010010087227   Scan not available.

1369. harshhacharitamuu  kaashiinaathaa paand-d'uran'ga paraba; Religion, 1818, , 300 pages. Barcode 5010010087178   Scan not available.

1370. Hashacharitha Sangraha  Subrahmanya Shastri; Religion. Theology, 1960, Sri Bala Manoram Mudhralaya, 96 pages. Barcode 5010010000890   Scan not available.

1371. hashhachaaratasan'grahan  Bhana Bhatta; Literature, 1850, SRI BAALAMANORAMAAKUDRAYATHRALAYA, 93 pages. Barcode 5010010006985   Scan not available.

1372. hashhacharitasan'grahan  Subramanya Sastry; Linguistics Literature, 1960, Sri Bala Manohara Mudranalaya,Chennai, 96 pages. Barcode 5010010004999   Server error, availability unknown.

1373. Hashhaicharitamu  shan'karakrutayaa san'ketaakhyayaa; Language. Linguistics. Literature, 1897, Tukaram Javaji,Bombay, 264 pages. Barcode 5010010032866   Scan not available.

1374. hashhaicharitan  Bhana Bhatta; Literature, 1933, Trivendrum, Kerala, 476 pages. Barcode 5010010006984   Scan not available.

1375. hashhaicharitan' eka saan'skrutika gradhyayana  Vasudeva Agarwal; Linguistics Literature, 1964, Bihar Rashtra Basha Parishad Patna, 336 pages. Barcode 5010010004998   Server error, availability unknown.

1376. hastalikhitagrandhavivarand-apajjikaayaan  T P Upadhyaya; Religion, 1791, Shri Vishweshwar Press Banaras, 414 pages. Barcode 5010010004370   Server error, availability unknown.

1377. Hastalikhitagranthaanukramand-ikaa  khare kulotpanna harisuunu gand-esha; Religion. Theology, 1960, gan' naa mujumadaara puuna, 372 pages. Barcode 5010010024535   Scan not available.

1378. Hasya And Prahasana A Critical Study  Dr Suram Srinivasulu; Unknown, 1989, TELUGU UNIVERSITY, 308 pages. Barcode 2020010005291   Scan available.

1379. hat'hayogapradiipikaa dhvitiyo bhaagan  Bhana Bhatta; Hathayoga, 1933, The Theosophical Publishing House,Madras, 238 pages. Barcode 5010010006986   Scan not available.

1380. Hatopadesha  Shri Dhanya Kumari; Unknown, 999, Paramshutraprabhavak_Mandal, 98 pages. Barcode 2020010005297   Scan available.

1381. Hayata  shriivibhuutibhuushhand-aabhat't'aachaarya; Language. Linguistics. Literature, 1967, san'skrxtavishvavidhyaalaya, vaaraand-asii, 190 pages. Barcode 5010010025701   Scan not available.

1382. Heitriiyoopanishhadi Shiqs-aavalli  Not Available; Religion. Theology, 999, aadhyaatmaprakashakaaryaalaya, 97 pages. Barcode 5010010017938   Scan not available.

1383. Hemaadra Uura~pha Hemaad'apan'ta Yaachen' Charitra  Aappaapaadydhye Keshava~; Geography. Biography. History, 1939, Kaamata Prin't'inga Presa, 500 pages. Barcode 2030020016518   Scan not available.

1384. Hetubhindut'hiikaa  Bhat't'a Aara~ya; Philosophy. Psychology, 1949, Barod'a Orien't'ala Inst'it'yut'a~, 530 pages. Barcode 2030020016365   Scan not available.

1385. Hetubindutika Of Butta Arcata  Pandit Sukhlaji Sanghavi; Unknown, 1949, Baroda_Oriental_Insttitue, 520 pages. Barcode 2020010005306   Scan available.

1386. Higher Sanskrit Grammar  ramchandra kale m; Language. Linguistics. Literature, 0, ramanarayana lal beni prasad hyderabad, 718 pages. Barcode 2020050036068   Scan not available.

1387. Hindhi Patra Lekhan  k.s. ramaswami shastri; Language. Linguistics. Literature, 1932, hindhi prachaar press, 102 pages. Barcode 2020050058035   Scan not available.

1388. Hindi Zou Vacabulary  yashaavanth vaasudhev paatnkar; Language. Linguistics. Literature, 1975, naagaaland bhasha parishath, 42 pages. Barcode 2020050058029   Scan not available.

1389. Hinduism  Govinda Das; Unknown, 1986, Sanjay Prakashan, 470 pages. Barcode 2020010005314   Scan available.

1390. Hindusthaanakaa Dand-d'asn'grah  pand-d'ita baladeivapraasaada; Language. Linguistics. Literature, 1959, shriivenkat'eshvaraa st'iimuu mudraalaye, 335 pages. Barcode 5010010012568   Scan not available.

1391. Hints Of The Study Of Sanskrit Compounds  Narayana Govinda Ratanjanikar; Religion. Theology, 1698, Tukaram Javaju, 130 pages. Barcode 5010010000909   Server error, availability unknown.

1392. History Of Sanskrit Poetics  P V Kale; Religion. Theology, 2002, Motiilaala Banaarasiidaasa, 466 pages. Barcode 2020050017237   Scan available.

1393. History Of The Duta Kavyas Of Bengal  Dr Jatindra Bimal Chaudhuri; Unknown, 1953, J_B_Chaudhuri_Institute_Of_Oriental_Learning, 134 pages. Barcode 2020010005324   Scan available.

1394. Hitoopadeisha  shrii naaraayand-a pan'nd-d'it'a; Language. Linguistics. Literature, 1935, The Nirnaya Sagar Press , Mumbai ., 145 pages. Barcode 5010010012691   Scan not available.

1395. hitoopadesha'  vishnusarma; Religion, 1830, Sastra Prakasha Press, Calcutta, 538 pages. Barcode 5010010087209   Scan not available.

1396. hitopadeshan  Vishnu Sarma; Religion. Theology, 1981, Srikrishna_Das_Mumbay, 138 pages. Barcode 5010010005039   Server error, availability unknown.

1397. Hitopadeshan  shriinaaraayand-apand-ita; Language. Linguistics. Literature, 1928, Sri Rama Press, Madras, 166 pages. Barcode 5010010032595   Scan not available.

1398. Hitopdesh  pandit narayanan; Language. Linguistics. Literature, 1908, gopal narayen and co bombay, 152 pages. Barcode 2020050057979   Scan not available.

1399. Hitopdesh  Kiranvalli; Unknown, 1973, Chowkhamba_Sanskrit_Series_Office, 197 pages. Barcode 2020010011732   Server error, availability unknown.

1400. Hitopdesh Mitrlabh  Sri Krishnavallabha Charya; Unknown, 999, CHOUKHAMBA SANSKRIT SERIES OFFFICE,VARANASI., 161 pages. Barcode 2020010011730   Server error, availability unknown.

1401. Hitopdesh Suharbudedh  Pt.hargovind Shastry; Unknown, 999, CHOUKHAMBA SANSKRIT SERIES OFFICE,VARANASI, 120 pages. Barcode 2020010011731   Server error, availability unknown.

1402. hn'sasan'desha  vedaantaachaarya; LANGUAGE. LINGUISTICS. LITERATURE, 1913, The Government Branch Press , Mysore, 652 pages. Barcode 5010010080122   Scan not available.

1403. Hoorabijnaanrahasyam Jyotishkalpabriksha  naarayanachandra jyotirbhushan bhattacharya; Language. Linguistics. Literature, 0, Not available, 231 pages. Barcode 5010010024541   Scan not available.

1404. Hrxdayaamrxtamu  shriijaganaathapand-d'ita; Language. Linguistics. Literature, 1980, oriental research institute, mysore, 122 pages. Barcode 5010010025702   Scan not available.

1405. hrxdayapriya of parameshvara  K . Sambasiva Sastri; Technology, 1931, Oriental Manuscripts , Trivandrum, 445 pages. Barcode 5010010026475   Scan not available.

1406. hstyaayuveda book 1  paalakaapyamuni; Technology, 1894, Ananda Ashrama Publications, 413 pages. Barcode 5010010026474   Scan not available.

1407. Ht'hayoogapradiipikaa  khemaraaja shriikrxshhnd-adaasashreshht'inaa; Language. Linguistics. Literature, 1825, shriivenkat'eshvaraa st'iimuu mudraalaye, 192 pages. Barcode 5010010012573   Scan not available.

1408. Hymns From The Rgveda  Peterson Peter; Religion. Theology, 1938, Suthankara, 515 pages. Barcode 2030020016189   Scan not available.

Return to the top

I


1409. i Tsin'ga Aura Bhaarata Yaatra  jayakaanta mishra; Language. Linguistics. Literature, 1972, gayaaprasaada end-d'a sansa, 163 pages. Barcode 5010010012566   Scan not available.

1410. Iishaadhyaashht'ottarashatopanishhada Aadhyantatattachchhaantiyuja  pand-ashiikaropahvavidvadddaralaqs-kand-asharma; Language. Linguistics. Literature, 1932, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 574 pages. Barcode 5010010024544   Scan not available.

1411. iishaadi dashopanipada  lakshhmand-a shaastriind-aa; Literature, 1897, Kashyhitachintakannasi Press, 608 pages. Barcode 5010010092166   Scan available.

1412. Iishaadyashht'itarashtopanishhada Aadyantatatachchhaantiyuj  vasudevasharamand-aa; Language. Linguistics. Literature, 1917, tukaaraam jaavajiishreshht'inaa, 456 pages. Barcode 5010010012565   Scan not available.

1413. iishaadyashht'ootarashatoopanishhada'  wasudeva laxmana shastri pansikara; Religion, 1913, Nirnaya Sagar Press, Bombay, 1160 pages. Barcode 5010010087219   Scan not available.

1414. Iishaavaasyat'iikaaraghunaathariirthiiya  Not available; Religion. Theology, 0, Not available, 55 pages. Barcode 5010010024545   Scan not available.

1415. Iishaavaasyoopanishhada  Not Available; Language. Linguistics. Literature, 0, Geetha Press , Gorakpur ., 62 pages. Barcode 5010010012641   Scan not available.

1416. iishaavaasyopanishhad  daamodara saan'valaaraama; Literature, 1911, Not available, 248 pages. Barcode 5010010092103   Scan available.

1417. Iishaavaasyopanishhada~  Bhin'd'a Sadaashivashaastrii; Religion. Theology, 1930, Raajaguru Aand-i Kan'paniija~ Presa~, 90 pages. Barcode 2030020016299   Scan not available.

1418. Iishaavaasyopanishhata~ Grantha 5  Shan'karaananda; Religion. Theology, 1934, Aanandaashramamudrand-aalaye, 105 pages. Barcode 2030020016117   Scan not available.

1419. Iishaavaasyopanishhatuu Khan'd'aartha  Not available; Language. Linguistics. Literature, 0, Not available, 238 pages. Barcode 5010010018019   Scan not available.

1420. Iishrvarapratyabhijnaavivrxtivimara~shini  Gupta Abhinava; Religion. Theology, 1941, Nira~naya Saagara~ Presa~, 457 pages. Barcode 2030020016241   Scan not available.

1421. Iishrvarapratyabhijnaavivrxtivimara~shinii Trxtiya Bhaaga  Gupta Abhinava; Religion. Theology, 1943, Nira~nd-aya Saagara~ Mudrand-aalaye, 423 pages. Barcode 2030020016256   Scan not available.

1422. Iishvara Pratyabhi Nj-aavivrxti Vimara~shinii Prathamo Bhaaga Grantha 60  Gupta Mada Abhinava; Religion. Theology, 1938, Madhusudhana Kaula Shaastrii, 323 pages. Barcode 2030020016147   Scan not available.

1423. Iishvara Pratyabhinj-aa Prathamo Bhaaga Grantha 22  Deva Utpala; Religion. Theology, 1921, Nira~nd-aya Saagaraakhya, 360 pages. Barcode 2030020016138   Scan not available.

1424. Iishvaraanumaanan  shriimadugadgasheipaadhpaadhhyaya; Language. Linguistics. Literature, 1915, shriikaamakhyanaya Tarkavagashone, 103 pages. Barcode 5010010032909   Scan not available.

1425. Iishvaradarshanamu Tachchaitatu  shriimatparamahan'sabrahmaanan'dasvaaminaa; Language. Linguistics. Literature, 1916, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 266 pages. Barcode 5010010024546   Scan not available.

1426. iishvarapratipattiprakaasha qs-imadhusudanasarasvatiprand-ita  T. Ganapathi Sastri; Philosophy. Psychology, 1921, The Maharaja of Travancore, Trivandrum, 26 pages. Barcode 5010010026473   Scan not available.

1427. Iishvarapratyabhinj-aa Dditiiyo Bhaaga Grantha 33  Deva Utpala; Religion. Theology, 1921, Nira~nd-ayasaagara, 302 pages. Barcode 2030020016040   Scan not available.

1428. Index Verborum Part 1  R Shama Shastri; Unknown, 1924, The Government Branch Press, 457 pages. Barcode 2020010005355   Scan available.

1429. Index Verborum Part Ii  Dr R Shama Shastry; Unknown, 1925, The_Government_Branch_Press, 454 pages. Barcode 2020010005357   Scan available.

1430. Index Verborum Part Iii  Arthasasthra Visarada; Unknown, 1925, Government_Branch_Press, 354 pages. Barcode 2020010005356   Scan available.

1431. Indian Scientific Nomenclature Of Birds Of India Burma And Ceylon Vol X X  Raghu Vira; Unknown, 1949, Shri Lokesh Chandra, 632 pages. Barcode 2020010005371   Scan available.

1432. Indo Aryan And Hindi  Suniti Kumar Chatterji; Unknown, 1942, Gujarath_Vernacular_Society, 274 pages. Barcode 2020010005375   Scan available.

1433. Indrajaalavidyaasan'graha  Not available; Language. Linguistics. Literature, 0, Not available, 382 pages. Barcode 5010010025704   Scan not available.

1434. Indraprasthaprabandha  dasharatha sharma; Language. Linguistics. Literature, 1963, raajasthaana praachyavidhyaa pratishht'haana, jodhpuuru, 64 pages. Barcode 5010010025705   Scan not available.

1435. Indravijay  Sri Madhusudan Sharma; Unknown, 1930, SREE AAPRADHYA DATT THAKUR SARVEYADHIKARI GRANTHADHEEN, 290 pages. Barcode 2020010005379   Scan available.

1436. Influence Of Kalidasa On Harshavardhana  N Padmavathy; Unknown, 1990, TELUGU UNIVERSITY, 168 pages. Barcode 2020010005381   Scan available.

1437. Intermediat Patchabagh  -; Unknown, 1969, The Directore Andhra University Press, 78 pages. Barcode 2020010005390   Scan available.

1438. Intermediate Sanskrit First Year  i srinivasa rao; Unknown, 999, vikram publishers, 132 pages. Barcode 2020010005388   Scan available.

1439. Intermediate Sanskrith Selections  G V Devasthali; Unknown, 1953, Booksellers_Publishing, 258 pages. Barcode 2020010005389   Scan available.

1440. Introduction To Kayachikitsa  C Dwarakanatha; Unknown, 1986, Chaukhambha_Orientalia, 436 pages. Barcode 2020010005395   Scan available.

1441. Introduction To The Devanagari Script  H M Lambert; Unknown, 1953, Oxford_University_Press, 100 pages. Barcode 2020010005396   Scan available.

1442. Introduction To The Study Of Mrcchakatika  G V Devasthali; Unknown, 1951, Poona_Oriental_Book_House, 192 pages. Barcode 2020010005397   Scan available.

1443. Introduction To The Study Of Mudra Raksasa  G V Devasthali; Unknown, 1948, Keshav_Bhikaji_Dhavale, 176 pages. Barcode 2020010005398   Scan available.

1444. Irishadi Dashopanishada  shankar bhashya; Philosophy. Psychology, 0, vanivilas sanskrit pustakalaya, 1020 pages. Barcode 2020050036373   Scan not available.

1445. Ishaadidashopanishhada Bhaashhya Sametamu  shrii shang-karaachaarya; Religion. Theology, 1964, motilaala banaarasiidasa, dilli, 42 pages. Barcode 5010010025706   Scan not available.

1446. Ishht'aasiddhi Savivarand-aa  vimuktaatma; Language. Linguistics. Literature, 1933, oriental institute, baroda, 750 pages. Barcode 5010010025708   Scan not available.

1447. ishht'asiddhi  M. Hiriyanna; Philosophy. Psychology, 1933, Oriental Institute, Baroda, 306 pages. Barcode 5010010026528   Scan not available.

1448. Ishvara Pratyabhijna Vimarshini Of Utpaladeva  Mukunda Rama Shastri; Unknown, 1918, Sir_Pratap_Singh_Sahib_Bahadur, 354 pages. Barcode 2020010005404   Scan available.

1449. Ishvara Pratyabhijna Vimarshini Vyaakyaayasahitamu Bhaaga 1  utpaladeva; Language. Linguistics. Literature, 1918, nirnayasagar press, bombay, 352 pages. Barcode 5010010024550   Scan not available.

1450. Ishvara Pratyabhijna Vimarshini Vyaakyaayasahitamu Bhaaga 2  utpaladeva; Language. Linguistics. Literature, 1921, nirnayasagar press, bombay, 296 pages. Barcode 5010010024551   Scan not available.

1451. Ishwarapratyabhijnaa Vimarshinii  utpaladeva; Religion. Theology, 1921, nirnayasagar press, bombay, 298 pages. Barcode 5010010024552   Scan not available.

1452. Isvasyopanished Asyam  V.r. Acharya; Unknown, 1933, THE SREENIVASA PRESS, TIRUVADHI, 178 pages. Barcode 5010010000774   Scan not available.

1453. Itihaasasamuchchaya  shriimadvachaasa; Language. Linguistics. Literature, 1973, laqs-miiveng-kad'eshvara mudrand-aalaya mun'bayii, 160 pages. Barcode 5010010025709   Scan not available.

1454. itihaasasan'graha  dattaatraya balavan'ta paarasaniisa saataaraa; Literature, 1908, Nirnayasagar Press , Mumbai, 54 pages. Barcode 5010010091957   Scan available.

1455. Itihasah Shaastra Va Tattvajnj-aana  Gupte Ke Esa~; Geography. Biography. History, 1947, Chitrashaala Presa~, 305 pages. Barcode 2030020016458   Scan not available.

1456. Iya Kunadali Vigyan  Sri Meethalal Himmatram Oojha; Unknown, 999, MUKUND JOSHI, 380 pages. Barcode 2020010004439   Scan available.

Return to the top

J


1457. jaa ta ka t'a ka thaa padamo bhaago  Venkataramaiah, R; Literature, 1992, BHARATEEYA JANAPITHA KASI, KASI, 405 pages. Barcode 5010010007045   Scan not available.

1458. Jaagadiishiisaamaanyaniruttki (Manuscript)  Sri Kasinatha Sastri; Philosophy. Psychology, 1873, Not Avavilable, 42 pages. Barcode 5010010029988   Scan not available.

1459. jaagadiishiivyadhikarand-amu  Dr R Latcha Raman; A Collection Of Essays On 21 Temples Located In Tamil Nadu, 1996, Prof. Pon. Sowriraasanaar Noolagam, 295 pages. Barcode 5010010007039   Scan not available.

1460. Jaambavati Parinayam  krishnadevaraaya; Language. Linguistics. Literature, 1969, andhra pradesh saahitya akademy hyderabad, 178 pages. Barcode 2020050057951   Scan not available.

1461. jaanakiiparind-aya  ta. gand-apatishaastrind-aa; Literature, 1913, Rajakeeya Press, 118 pages. Barcode 5010010091993   Scan not available.

1462. Jaanakiiparind-ayanaat'akamu  Not Available; Language. Linguistics. Literature, 0, Not available, 468 pages. Barcode 5010010012059   Scan not available.

1463. Jaataka Ratnaakara  kai jyotishhaachaarya dvaarakaanaatha naaraayand-a raaje; Language. Linguistics. Literature, 1890, pu dvaa raaje puund-e, 434 pages. Barcode 5010010025928   Scan not available.

1464. Jaatakaabharan  -; Vacant, 0, kemraj shrikrishnadass mumbai, 428 pages. Barcode 2020050043604   Scan not available.

1465. Jaatakaabharan  -; Vacant, 999, kemraj shrikrishnadass mumbai, 428 pages. Barcode 2020050067589   Scan not available.

1466. Jaatakapaarijaata  Daivajana Vaidyanatha; Vacant, 999, Chaukahambha Sanskrit Sansthan Varanasi, 582 pages. Barcode 2020050067585   Scan not available.

1467. Jaatakapaarijaata Adhyaaya 11 15  v. subrahmanyashastri; Religion. Theology, 1904, nirnayasagar press, bombay, 178 pages. Barcode 5010010024560   Scan not available.

1468. Jaathakadesha Margaha Chandrika  gopesh kumar ahoja; Unknown, 999, motilal banarsidas, 342 pages. Barcode 2020010005414   Scan available.

1469. Jagadaguru Shriisachchidaanandasivaabhinava Nusin'habhaaratiivijayakaavyamu  sa raajavallabha sastrigala; Language. Linguistics. Literature, 1934, The Madras Law Journal Press , Chennai ., 446 pages. Barcode 5010010012548   Scan not available.

1470. jagadeshiit'iikaa  Not available; Literature, 1897, Not available, 708 pages. Barcode 5010010092115   Scan available.

1471. Jagadish Anumitha Grandhah  Pullagummi Venkatacharyulu; Unknown, 999, -, 714 pages. Barcode 2020010005418   Scan available.

1472. Jagadruru Sri Sacchidananda Sivabhinava Nrisimhabarathi Vijayakavya  Mahopadesaka S Rajavallabha Sastrigal; Linguistics Literature, 1934, The Madras Law Journal Madras, 446 pages. Barcode 5010010005103   Server error, availability unknown.

1473. Jaimani Sutra Vritti Subhodini Namika  brahmachari sarveswaranand; Unknown, 999, set ramanlal chaukasi, 524 pages. Barcode 2020010005424   Scan available.

1474. jaimini ashwamedhaa  jaavaajii daadaajii; Literature, 1894, Nirnayasagar Press , Mumbai, 820 pages. Barcode 5010010092040   Scan not available.

1475. Jaiminigrxhmasuutrama~  Kalaan'da Vi; Religion. Theology, 1922, Motilaala Banaarasi Daasa, 171 pages. Barcode 2030020016146   Scan not available.

1476. Jaiminiiya Braahmand-an' Dditiiye Kaand-d'e  Lokeshachandrend-a; Religion. Theology, 1950, Sarasvatii, 146 pages. Barcode 2030020016022   Scan not available.

1477. Jaiminiiyaarshheya Jaiminiiyopanishhada Braahmand-e  be raamachanddrasharmand-aa; Religion. Theology, 999, The Central Sanskrit Institute Tirupathi, 357 pages. Barcode 5010010017386   Scan not available.

1478. jaiminiiyamiimaan'saasuutrapaat'he  Not available; Literature, 1878, Not available, 170 pages. Barcode 5010010092085   Scan available.

1479. jaiminiiyanaayamaalaavistara'  vidyaasaagarabhat'aachaaryaa; Religion, 1553, , 742 pages. Barcode 5010010087228   Scan not available.

1480. jaiminiiyanyaaya maalaavi  Madhvacharya; Linguistics Literature, 1844, Govardhan Mumbai, 133 pages. Barcode 5010010005105   Server error, availability unknown.

1481. Jaiminiiyanyaayamaalaa  hari naaraayand-a aapt'ei; LANGUAGE. LINGUISTICS. LITERATURE, 1916, aanandaashramasudrand-aalayei aayasaashraraimudravitvaa prakaashitaa, 840 pages. Barcode 5010010079430   Scan available.

1482. jaiminiiyanyaayamaalaa  mahaadeva chimand-aajii aapat'e; Literature, 1814, Anand Chapkhana , Poone, 836 pages. Barcode 5010010092164   Scan available.

1483. jaiminiiyashrotasutravrutin  Raghu Veera; Religion. Theology, 1966, International Academy Of Indian Culture New Delhi, 365 pages. Barcode 5010010001006   Server error, availability unknown.

1484. Jaiminiiyasuutraand-i Subodhiniit'iikaasametaani Prathamamadhyaayadvayan' Sat'iikamagriman  maharshhi shriijaiminimuni; Language. Linguistics. Literature, 1969, shriiven'kat'eshvara st'iimu presa, bambayii, 82 pages. Barcode 5010010025930   Scan not available.

1485. Jaiminiya Arseya Jaiminiya Upanishad Brahmanas  B.r. Sharma; Unknown, 1984, Kendriya_Sanskrit_Vidyapeetha, 350 pages. Barcode 5010010001004   Scan not available.

1486. Jaiminiya Brahmana Of The Samaveda  Raghu Veera; Unknown, 1954, Saraswathi_Vihar, 538 pages. Barcode 2020010005425   Scan available.

1487. Jaiminiya Brahmana of the Samaveda  Raghuvira; Unknown, 1937, International Academg of Indian Culture,LAHORE, 105 pages. Barcode 5010010001016   Scan not available.

1488. Jainadara~shanasaara  Mallinathana Si Esa; Religion. Theology, 1950, Shrii Sabodha Gran'thamaalaa, 145 pages. Barcode 2030020016005   Scan not available.

1489. Jainashiilaa Lekha San'grah Dditiiyo Bhaaga  Muura~tii Vijaya; Language. Linguistics. Literature, 1952, Maand-ikachandra Digambara Gain Granthamaalaa Samiti, 536 pages. Barcode 2030020016133   Scan not available.

1490. Jainendra Mahavritti Of Shri Abhayanandi  shambhunath tripathi; Unknown, 1956, bharathiya jnanapitha kashi, 568 pages. Barcode 2020010005427   Scan available.

1491. Jainendravyaakarand-ama~  Devanandimunii; Language. Linguistics. Literature, 1920, Gavara~namen't'a~ Sanskrxta Kaaleja~ Pustakaalaya Banaarasa~, 455 pages. Barcode 2030020015993   Scan not available.

1492. Jaipur Ki Saskrith Sahitya Ko Daen  Dr Prabhakar Shastry; Unknown, 1980, Sharna_Book_Depo, 333 pages. Barcode 2020010005428   Scan available.

1493. Jaisinhakalpadrumah Dharmashstragranth 1  Panditharinarayansharmami; Unknown, 1982, Laxmivenkateshwar_Mudranalay, 940 pages. Barcode 2020010005429   Scan available.

1494. Jalabheda  Sri Vallabhacharya; Unknown, 999, Sri_Ratnaprabha_Bahuji_Maharaj, 81 pages. Barcode 5010010001007   Scan not available.

1495. Jambhavati Parinayam  Dr B Ramaraju; Unknown, 1969, ANDHRA PRADESH SAHITYA ACADEMY, 170 pages. Barcode 2020010005433   Scan available.

1496. Jambu Chariyam Number Xxxxiv  Acahrya Jinvijay Muni; Unknown, 999, ADHISHTAHA SINDHI JAIN SHASTRA SHIKSHA PEETH, 248 pages. Barcode 2020010005434   Scan available.

1497. Jaminiya Arseya jaiminiya Upanishad Brahmanas  Bellikoth Ramchandra Sharma; Unknown, 1984, Kendriya Sanskrit Vidyapeetha, 344 pages. Barcode 2020010011847   Server error, availability unknown.

1498. Janasrayi  Ramakrisha Kavi.m; Linguistics Literature, 1950, T.T.D Tirupati, 76 pages. Barcode 5010010001009   Scan not available.

1499. Janmapatra Vidhaanamu Sodaaharand-a Tattvaprabhaa Hindiivyaakhyaaya  aachaarya shrii pan' lashhand-alaala bhvaa; Language. Linguistics. Literature, 1980, chaukhambaa amarabhaaratii prakaashana vaaraand-aasii, 84 pages. Barcode 5010010028193   Scan not available.

1500. Jataka Parijata Adhyayas 11-15  V. Subramanya Sastri; Language. Linguistics. Literature, 1904, Nirnaya Sagar sanya Mudranalaya, Mumbai, 247 pages. Barcode 5010010024572   Scan not available.

1501. Jatakattha Katha  Bhikshu Dharm Rakshit; Unknown, 1951, Bharatiya_Jnanapitha_Kashi, 408 pages. Barcode 2020010005458   Scan available.

1502. Jatakatthakatha Vol I  Tripitakacharya Bhikshu Dharma Rakshit; Unknown, 1944, Bharatiya Jnanapitha, 406 pages. Barcode 2020010005457   Scan available.

1503. Jathaka Baranamu  Unknown; Religion. Theology, 999, Unknown, 175 pages. Barcode 5010010010790   Scan not available.

1504. Jathaka Baranamu  Unknown; Religion. Theology, 999, Unknown, 296 pages. Barcode 5010010010809   Scan not available.

1505. Jathaka Bharanam  Achyatananda; Astrology, 1951, VIDHA VILASA PRESS, BANARAS, 442 pages. Barcode 5010010001010   Scan not available.

1506. Jathakat'a~t'hakathaa Prathama Bhaaga  Bhiqs-u Dhara~maraqs-ita; Religion. Theology, 1951, San'saara~ Presa Kashiipura, 414 pages. Barcode 2030020016235   Scan not available.

1507. Jauminiiyanyaayamaalaa Part I  pn' . pat't'abhiraama; LANGUAGE. LINGUISTICS. LITERATURE, 1937, Jai Krishnada Haridas Gupta , Benares, 290 pages. Barcode 5010010042558   Scan not available.

1508. Javaahara~lala~ Neharu Aatmacharitra  Gandesha~gore Naaraayand-a; Geography. Biography. History, 1947, Shrii Laqs-miinaaraayand-a Presa~, 694 pages. Barcode 2030020016515   Scan not available.

1509. Jayadevacharitram  G Laxmi Kantaiah; Unknown, 1976, -, 64 pages. Barcode 2020010005476   Scan available.

1510. Jayapoorva Bhavamu  -; Unknown, 1931, Jayapuragre_Mudrithamu, 714 pages. Barcode 2020010005485   Scan available.

1511. Jayapura Raja Vamsyavali  pundit ramanatha anda sarma; Geography. Biography. History, 1938, jeypore samasthanam, 288 pages. Barcode 2020050058020   Scan not available.

1512. Jayasri Grandhavali  Rajanadh Sarma; Unknown, 1971, Vinod Pustak Mandir, 1076 pages. Barcode 2020010011872   Server error, availability unknown.

1513. Jeevanandanamu  Pandit Narayan Datta Vaidy; Unknown, 999, -, 264 pages. Barcode 2020010005494   Scan available.

1514. Jeevandhara Champuh  Pandit Pannalal Jain Sahitya Charya; Unknown, 1958, Ayodhya_Prasad_Goyaliya, 408 pages. Barcode 2020010005498   Scan available.

1515. Jeinaraajakuutat'iikaasahitt Puuthviiraaja Vijayaakhaya Mahaakaavyamuu  s k belvarkar; GEOGRAPHY. BIOGRAPHY. HISTORY, 1914, The Asiatic Society ParkStreet ,Calcutta, 524 pages. Barcode 5010010078843   Scan available.

1516. Jigyansadhikarnpoorvapaksh  -; Unknown, 999, -, 188 pages. Barcode 2020010005511   Scan available.

1517. jiind-iidvarahavanapaddatin' san'praaqs-and-avidhitra  Raghavendra Acharya; Vacant, 1891, Vedik Grandha Prakasha Gada, 52 pages. Barcode 5010010001023   Server error, availability unknown.

1518. jiivandharachampun  Pannalal Jain; Philosophy, 1957, Bharatiya Gyan Peet,Kashi, 397 pages. Barcode 5010010005118   Server error, availability unknown.

1519. jiivasaj'jivijnaat'akamu  Ramakrishna Bhatt; Religion, 1947, N.Mallikarjuna Sharma, 322 pages. Barcode 5010010001019   Server error, availability unknown.

1520. Jiivavichaara Prakarand-amuu  shrii shaantisuuriisvaraji; Language. Linguistics. Literature, 0, Not Available, 242 pages. Barcode 5010010012639   Scan not available.

1521. Jinaratnakosa Vol I  Hari Damodar Velankar; Unknown, 1944, Bhandarkar Oriental Research Institute, 488 pages. Barcode 2020010005512   Scan available.

1522. Jinasahasranaama  Aashaadhara Pand-d'ita; Religion. Theology, 1954, Bhaaratiiya Jnaanapit'ha Kaashii, 304 pages. Barcode 2030020016275   Scan not available.

1523. Jitante Stotram  Balasharma; Religion, 1867, Ganesha, 88 pages. Barcode 5010010001024   Scan not available.

1524. Jivanandanam  M.duraiswami Aiyangar; Unknown, 1947, The Adyar library, 576 pages. Barcode 2020010005513   Scan available.

1525. Jnaanaara~nd-avatantrama~  Iishvara~ Proktama~; Religion. Theology, 1952, Aanandaashrama Mudrand-alayan', 141 pages. Barcode 2030020016292   Scan not available.

1526. Jnaneshwari  Ramchandra Kesava Bhagwat; Unknown, 1954, Samata Books, 736 pages. Barcode 2020010005518   Scan available.

1527. Jotisha Prasna Phala Ganana  Pandit dayashanleareupadhyaya; Religion. Theology, 1975, Chowieamsiler vidyabhavan varanasi, 56 pages. Barcode 2020050017184   Scan available.

1528. Journal Of Sri Venkateswara Orintal Institute Tiruoathi Vol 2  Sarasvatihrdayalankara; Philosophy, 0, Superintendent Research Jammu And Kashmir State Sribagar, 134 pages. Barcode 5010010005123   Server error, availability unknown.

1529. Jyaneswarinche Shabda Bhandar  Ram Chandra Narayan Velingkar; Unknown, 1959, Marathi_Sanshodhan_Mandal, 772 pages. Barcode 2020010005532   Scan available.

1530. Jyautishha- San'hhitaa  aacharya baskaranand lohini; General, 2005, agrahayanaprakasana luknow, 272 pages. Barcode 2020050017227   Scan not available.

1531. Jyothishshamasangraha Jaathakbhag  shyam lal; Unknown, 1995, somaraj krishna das, 416 pages. Barcode 2020010005537   Scan available.

1532. Jyothisyashhabdakoshha:  Pandit Sreemathru Prasadha Pandeya; General, 2005, chowkhamba vidyabhawan, 440 pages. Barcode 2020050017225   Scan not available.

1533. Jyotirgand-itamu  Not available; Language. Linguistics. Literature, 0, Not available, 476 pages. Barcode 5010010028299   Scan not available.

1534. Jyotirveidan  gobboru venkatananda raghavarao; General, 2005, laksmi art printers, 230 pages. Barcode 2020050017232   Scan not available.

1535. Jyotirvidaabharand-aamu Sukhabodhikaa  shriikaalidaasa; Language. Linguistics. Literature, 1988, veidamu vein'kat'araayashaastri, madraasu, 675 pages. Barcode 5010010024590   Scan not available.

1536. Jyotishha Ratnaakara  devakiinandana sih; General, 2005, motiilaala banaarasiidaasa dillii, 1118 pages. Barcode 2020050017206   Scan available.

1537. Jyotishha Shiromand-i Bhaaga Duusaraa Drxshht'aan'ta Vibhaaga 4625 Janmakun'd'alike Shaata Nirayana Chitraan'sha  manubhai s. shah; Language. Linguistics. Literature, 0, shah birth chart prediction house, nargol, 338 pages. Barcode 5010010025935   Scan not available.

1538. Jyotishha Vdaaraa Roga Upacchara  prem kumer sarma; General, 2005, diraj punkaj books, 214 pages. Barcode 2020050017198   Scan available.

1539. Jyotishhatattvasudhaarnd-ava Bhaashhaat'ikayaa  daralaalasharmand-a; Language. Linguistics. Literature, 1848, saqs-miiven'kat'eshvara st'iimu mudrand-aalaya mun'bayii, 516 pages. Barcode 5010010025934   Scan not available.

Return to the top

K


1540. Kaadamabariisn'graha  r v krishnamachariar; LANGUAGE. LINGUISTICS. LITERATURE, 1916, sadanandanilaya press, madras, 220 pages. Barcode 5010010078307   Scan available.

1541. kaadambarii  Peterson; Natural Sciences, 1889, Bombay Sanskrit Series Bombay, 374 pages. Barcode 5010010005136   Server error, availability unknown.

1542. Kaadambarii Kalikaataaraajadhaanyaan  Not available; Language. Linguistics. Literature, 0, Not available, 419 pages. Barcode 5010010024592   Scan not available.

1543. Kaadambarii Shhashht'a Vrxtti  Shriibaand-abhaat't'aa Mahaakavii; Language. Linguistics. Literature, 1921, Nira~naya Saagara~ Yantraalayan', 623 pages. Barcode 2030020016529   Scan not available.

1544. Kaadambariikalyaand-an' Naat'akama~  Kavii Narasin'ha; Language. Linguistics. Literature, 1936, Da Hin'dii Prachara~ Presa~, 264 pages. Barcode 2030020016448   Scan not available.

1545. kaadambarisaaraa  Mahadev Shivaram Apte; Literature, 0, B.M.Apte Bombay, 350 pages. Barcode 5010010001039   Server error, availability unknown.

1546. Kaalaamrxtei Savyaakhyaanei  Not available; Language. Linguistics. Literature, 0, Not available, 286 pages. Barcode 5010010028301   Scan not available.

1547. Kaalagn-aanamu Bhaashhaat'iikaasametamu  Not available; Language. Linguistics. Literature, 0, Not available, 218 pages. Barcode 5010010025767   Scan not available.

1548. Kaalamaadhava  Chaara~ya Maadhava; Religion. Theology, 1909, Harikrxshhnd-adaasa, 247 pages. Barcode 2030020016134   Scan not available.

1549. Kaalatattvavivechanamam' Part I  Raghunatha Bhatta; Social Sciences, 1932, B. C. Banerjee, 280 pages. Barcode 5010010033934   Scan not available.

1550. Kaalatattvavivechanamam' Part Ii  Raghunatha Bhatta; Social Sciences, 1933, B. C. Banerjee, 306 pages. Barcode 5010010033798   Scan not available.

1551. Kaalidaasa  Miraashii Vaasudevavishhnd-u; Geography. Biography. History, 1934, Suvichaara Prakaashana~ Mand'ala Limited'a~, 314 pages. Barcode 2030020016356   Scan not available.

1552. Kaalidaasakaavyasaurabhamu  vidvaanu khan'd'avilli suuryanaaraayand-ashaastrii; Language. Linguistics. Literature, 1973, shriivijayalaqs-mii mudraaqs-arashaala, 108 pages. Barcode 5010010025768   Scan not available.

1553. Kaalidaasiiyama~ Rxtusan'haarand-ama~ Da~vitiiyo Granthaa  Kaalidaasa; Language. Linguistics. Literature, 1944, Panj-cha Naadaa Presa~ Limited'a~, 142 pages. Barcode 2030020016520   Scan not available.

1554. kaamaayanii  shrii jayashang-kara prasaada; LANGUAGE. LINGUISTICS. LITERATURE, 1993, bhaaratii bhaand-d'aara ilahaabaada, 378 pages. Barcode 5010010023378   Server error, availability unknown.

1555. Kaamandakiiyaniitisaara Bhaashhaat'iikaasahita  Not available; Language. Linguistics. Literature, 0, Not available, 228 pages. Barcode 5010010024596   Scan not available.

1556. Kaamasuutramu  durgaaprasaada; Religion. Theology, 1900, Nirnayasagar Mudranalaya, 392 pages. Barcode 5010010025770   Scan not available.

1557. Kaamasuutramu T'ikayaa Sametamu  shriivaatsyaayanamuni; Language. Linguistics. Literature, 0, chaukhamba sanskrit series office, benares, 360 pages. Barcode 5010010025771   Scan not available.

1558. Kaan'timati Parind-ayamu  shrii chokkanaatha makhi; Language. Linguistics. Literature, 1984, saraswathi mahal library, thanjavur, 194 pages. Barcode 5010010028283   Scan not available.

1559. kaand-aadasiddhaantachandrikaa  ta. gand-apatishaastrind-aa; Literature, 1913, Rajakeeya Press, 76 pages. Barcode 5010010092002   Scan available.

1560. Kaarakasan'bandhodhyota  rabhaasanan'di; Language. Linguistics. Literature, 1956, Rajasthan Oriental Research Institute , Jaipur ., 64 pages. Barcode 5010010012564   Scan not available.

1561. Kaarikaavali Nyaayasiddhaantamuttkaavalii  Vishwanatha Panchanan Bhattacharya; Philosophy. Psychology, 1895, Sri Govardhan Ramsahu Ramlalsahu, 534 pages. Barcode 5010010029957   Scan not available.

1562. Kaarikaavali Nyaayasiddhaantamuttkaavalii Cha Chitravali  Vishwanatha Panchanan Bhattacharya; Philosophy. Psychology, 1939, Sri Chandrahari Sinha Sharma, Madhubhani, 422 pages. Barcode 5010010029967   Scan not available.

1563. Kaarikaavali Siddhaantamukttaavali T'ippand-ii  shriivishvanaathapanj-chaananabhat't'aachaarya; Language. Linguistics. Literature, 1903, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 90 pages. Barcode 5010010028293   Scan not available.

1564. Kaarikaavali Siddhanta Muktavali  vishvanaatha panchaanana bhatta; Language. Linguistics. Literature, 1915, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 98 pages. Barcode 5010010024601   Scan not available.

1565. Kaarikaavalii  vishvanaathapachaana; LANGUAGE. LINGUISTICS. LITERATURE, 1924, Nirnaya Sagar Press , Bombay, 89 pages. Barcode 5010010042555   Scan not available.

1566. Kaarikaavalii Muktaavalii  shriivishvanaathapanj-jaananabhat't'aachaarya; Language. Linguistics. Literature, 1951, chaukhamba sanskrit series office, benares, 556 pages. Barcode 5010010025772   Scan not available.

1567. Kaarikaavalii Mukttaavaliida~vitiiyan' San'skarand-ama~  Bhat't'aachaara~ya; Philosophy. Psychology, 1951, Vidhyaa Vilaasa Presa~, 563 pages. Barcode 2030020015980   Scan not available.

1568. Kaarikaavalii Nyaayasiddhaantamuktaavali  shriimanmahaamahopaadhyaayavidhyaanaathapanj-chaananabhat't'aachaarya; Religion. Theology, 0, Not available, 560 pages. Barcode 5010010024600   Scan not available.

1569. kaaryaadhikarand-avaada  shriiran'gaachaaryend-a; Literature, 1901, Sri Sudarshan Printing Press, 72 pages. Barcode 5010010092165   Scan available.

1570. Kaashaakrxtsna Dhaatuvyaakhyaanamu Naat'akat'ikaa San'skrxtaruupaantaramu  shriichannaviirakavi; Language. Linguistics. Literature, 1965, san'chaalaka bhaaratiiya praachyavidhyaa pratishht'haanamu ajamera, 344 pages. Barcode 5010010028302   Scan not available.

1571. Kaashi Kaa Vivarand-a Panj-jikaa Khand-d'a 3  Buddhi Jinendra; Language. Linguistics. Literature, 1925, Varendra Risara~cha Sosaaiit'i, 545 pages. Barcode 2030020016130   Scan not available.

1572. Kaashi Kaa Vivarand-a Panj-jikaa Vol Ii Part I  Chakravara~tii Chan'draa; Language. Linguistics. Literature, 1919, The Varendra Research Sosaacit'i, 643 pages. Barcode 2030020016083   Scan not available.

1573. Kaashiikhan'd'an' T'iikaa  shriiraamaanan'dayativara; Language. Linguistics. Literature, 1803, Not available, 596 pages. Barcode 5010010028284   Scan not available.

1574. Kaashikaa  Not available; Language. Linguistics. Literature, 0, Not available, 854 pages. Barcode 5010010024603   Scan not available.

1575. Kaashikaa  Not available; Language. Linguistics. Literature, 0, Not available, 484 pages. Barcode 5010010025773   Scan not available.

1576. Kaashikaa Dvitiiya Bhaaga  aaryeindhra sharma; Language. Linguistics. Literature, 1970, Samskruta Parishat Usmaniya Vishva Vidhyalaya, Hyderabad, 540 pages. Barcode 5010010028194   Scan not available.

1577. Kaashikaa Vivarand-a Panj-jikaa Bhaaga I Vol I  Buddhi Jinendra; LANGUAGE. LINGUISTICS. LITERATURE, 1913, Chandra Gan'guli, 365 pages. Barcode 2030020032379   Scan available.

1578. Kaashikaa Vivarand-a Panj-jikaa Bhaaga I Vol Ii  Buddhi Jinendra; LANGUAGE. LINGUISTICS. LITERATURE, 1919, Chandra Gan'guli, 197 pages. Barcode 2030020032361   Scan available.

1579. Kaashikaa Vivarand-a Panj-jikaa Bhaaga Iii Vol I  Buddhi Jinendra; LANGUAGE. LINGUISTICS. LITERATURE, 1915, Chandra Gan'guli, 175 pages. Barcode 2030020032369   Scan available.

1580. Kaashikaa Vivarand-a Panj-jikaa Bhaaga Iv Vol I  Buddhi Jinendra; LANGUAGE. LINGUISTICS. LITERATURE, 1916, Chandra Gan'guli, 200 pages. Barcode 2030020032373   Scan available.

1581. Kaashikaa Vivarand-a Panj-jikaa Bhaaga V Vol I  Buddhi Jinendra; LANGUAGE. LINGUISTICS. LITERATURE, 1916, Chandra Gan'guli, 275 pages. Barcode 2030020032364   Scan available.

1582. Kaashikaand-d'a Grantha  Not available; Religion. Theology, 0, Not available, 905 pages. Barcode 5010010024746   Scan not available.

1583. Kaashikaavivarand-apanj-jikaa Prathama Bhaaga  Buddhi Jinendra; Language. Linguistics. Literature, 1913, Da Varendra Risera~cha Sosait'i, 1131 pages. Barcode 2030020016219   Scan not available.

1584. Kaashmiiragranthaavalii Prathamakhand-d'amu  shriijagadiishachandra chat't'opaadhyaaya; Language. Linguistics. Literature, 1911, Not available, 246 pages. Barcode 5010010025682   Scan not available.

1585. Kaashmiirasandhaanasamudyama  Not available; Language. Linguistics. Literature, 0, Not available, 32 pages. Barcode 5010010028292   Scan not available.

1586. Kaashyapa San'hitaa  Not Available; Language. Linguistics. Literature, 1933, Sri Yathiraja Sampathkumaramuni Of Melkote , Mysore ., 214 pages. Barcode 5010010012563   Scan not available.

1587. kaashyapajnaanakaand-d'an  Ranga Swamy, S; Temples, 1948, Pandit bha. Paarthasaarathi bhattachaaryaha, 216 pages. Barcode 5010010007094   Scan not available.

1588. kaashyapasan'hitaa  Ranga Swamy, S; Temples, 1948, PANDIT BHA. PAARTHASAARATHI BHATTACHAARYAHA, 624 pages. Barcode 5010010007095   Scan not available.

1589. Kaasmiiragranthaavali Vol.iii  je.si. chat'arjii; Language. Linguistics. Literature, 1911, Kashmir Srinagar, 100 pages. Barcode 5010010024604   Scan not available.

1590. Kaasyapagnaanakandaha  Parthasarathy Battacharya. R.b; Literature, 1948, Pandit bha. Paarthasaarathi bhattachaaryaha, 216 pages. Barcode 5010010001091   Scan not available.

1591. kaasyapasan'hitaa  Sri Yathiraja Sampathkumaramuni; Philosophy. Psychology, 1933, Sri Yathiraja Sampathkumaramuni , Melkote, 220 pages. Barcode 5010010026527   Scan not available.

1592. Kaat'hakagrxhyasutrama~ Bhaashhyatrayasarasutama~  Vilomakaaland-d'a Shriidakt'ara~; Language. Linguistics. Literature, 1925, Hin'dii Presa~, 349 pages. Barcode 2030020016488   Scan not available.

1593. kaat'hakopanipate  chin'taamand-i gan'gaadhara bhaanu; Literature, 1912, Induprakash Press , Mumbai, 728 pages. Barcode 5010010092144   Scan available.

1594. Kaat'hakopanishhata~  Shriidhashaastrii Pan'd'ita; Religion. Theology, 1929, Orien't'ala Bukasaplxin'ga Ejansii, 217 pages. Barcode 2030020016061   Scan not available.

1595. Kaat'hakopanishhata~ Chatura~thiyamang-kanaavrxtti  Vyasadevena; Philosophy. Psychology, 1914, Aanandaashramamudrand-aalayan', 143 pages. Barcode 2030020016363   Scan not available.

1596. Kaat'hakopanishhata~ Grantha 7  Aapat'e Mahaadeva Chimand-a; Religion. Theology, 1935, Aanandaashramamudrand-aalaye, 147 pages. Barcode 2030020016116   Scan not available.

1597. Kaatyaayanashrautasuutramu Bhaashhyasahitamu  mahaamahopaadhyaaya shriikarkaachaarya; Language. Linguistics. Literature, 1908, chaukhamba sanskrit series office, benares, 1292 pages. Barcode 5010010026004   Scan not available.

1598. Kaavya Ke Ruupa  gulaabaraaya; Language. Linguistics. Literature, 1958, aatmaaraam end-d'a sn's, 270 pages. Barcode 5010010012638   Scan not available.

1599. Kaavya Prakaasha 15  Sin'h Satyavrata; Language. Linguistics. Literature, 1955, Chaukhambaa Vidhaa Bhavana, 389 pages. Barcode 2030020016028   Scan not available.

1600. Kaavyaadara~sha  Dand-d'i Aachaara~yaa; Language. Linguistics. Literature, 1936, Tiruvaadi Shriinivaasa Mudrand-aalaye, 412 pages. Barcode 2030020016319   Scan not available.

1601. kaavyaadarsha  mahaakavi shriidagdhaachaaryaa; Literature, 1863, Kalakatta Printing Press , Kalakatta, 464 pages. Barcode 5010010092137   Scan available.

1602. Kaavyaadarsha  aachaaryadand-d'i; Language. Linguistics. Literature, 1936, tiruvaadi shriinivaasa mudrand-aalaya, 400 pages. Barcode 5010010026005   Scan not available.

1603. Kaavyaadashar  acharya ramachandra mishra; General, 2005, chowkhamba vidyabhawan, 332 pages. Barcode 2020050017186   Scan available.

1604. kaavyaalaa chatudaishoo gun'chchhakan  Banhatti N d; , 1938, PANDURANG JAWAJI Pandurang Jawaji Proprietor Nirnaya Sagar Press Bombay, 176 pages. Barcode 5010010007106   Scan not available.

1605. Kaavyaalakaarasuutravuutta  kamadhenu; LANGUAGE. LINGUISTICS. LITERATURE, 1909, sri vani vilas press, srirangam, 224 pages. Barcode 5010010080073   Scan available.

1606. kaavyaalan'kaarasaarasan'grahan  Narayana Daso Banhatti; Linguistics, 1925, Bombay Educational Service, Bombay, 359 pages. Barcode 5010010007103   Scan not available.

1607. kaavyaalan'kaarasuutraand-i  pand-d'ita durgaaprasaadena; Literature, 1895, Nirnayasagar Press , Mumbai, 90 pages. Barcode 5010010092162   Scan available.

1608. Kaavyaalan'kaarasuutrand-i Svavrxttisamalan'krxtaani  pand-d'itavaravaamana; Language. Linguistics. Literature, 1953, nirnd-ayasaagara presa mun'bayii, 122 pages. Barcode 5010010028277   Scan not available.

1609. Kaavyaalan'kaarasuutrand-i Svavrxttisamalan'krxtaani  pand-d'itavaravaamana; Language. Linguistics. Literature, 1953, nirnd-ayasaagara presa mun'bayii, 114 pages. Barcode 5010010028281   Scan not available.

1610. Kaavyaalan'kaarasuutravuutti  kamadhenu; PHILOSOPHY. PSYCHOLOGY, 1909, Sri Vani Vilas Press ,Srirangam, 224 pages. Barcode 5010010078696   Scan available.

1611. Kaavyaanushaasanamuu  Pandurang Parab; LANGUAGE. LINGUISTICS. LITERATURE, 1915, The Nirnaya Sagar Press , Bombay, 78 pages. Barcode 5010010078303   Scan available.

1612. Kaavyaanushaasanamuu  vaagbhat't'aa; Language. Linguistics. Literature, 1915, The Nirnaya Sagar Press , Chennai ., 82 pages. Barcode 5010010012637   Scan not available.

1613. Kaavyaavali Ke Ratnaapaanchaalikaa  Singabhupala; Language. Linguistics. Literature, 1941, The Superintendent Government Press , Trivandrum ., 102 pages. Barcode 5010010012631   Scan not available.

1614. Kaavyad'aakinii  maithilashriigang-gaanandakavindra; Language. Linguistics. Literature, 1924, vidya vilasa press, benares, 69 pages. Barcode 5010010024606   Scan not available.

1615. kaavyadapaind-an  Narayana Iyyar; Linguistics Literature, 1952, Ramaswamy Shastrulu amp Sons,Chennai, 327 pages. Barcode 5010010005182   Server error, availability unknown.

1616. Kaavyadarshanamulyam  -; Language. Linguistics. Literature, 0, -, 160 pages. Barcode 2020050036060   Scan not available.

1617. Kaavyadiipikaa  parameshvaraananda; LANGUAGE. LINGUISTICS. LITERATURE, 1941, Moti Lal Banarsi Dass , Bombay, 312 pages. Barcode 5010010042524   Scan not available.

1618. kaavyakalaapan  J.singaraiyengar; Econo Politics, 1968, J.Singaraiyengar Tumkur, 70 pages. Barcode 5010010001109   Server error, availability unknown.

1619. kaavyamaalaa  pandita durgaprasada; Religion, 1899, , 166 pages. Barcode 5010010087226   Scan not available.

1620. kaavyamaalaa  pan'd'ita durgaaprasaadena; Literature, 1893, Nirnayasagar Press , Mumbai, 329 pages. Barcode 5010010092010   Scan not available.

1621. kaavyamaalaa san'grah 9  kaashiinaatha sharmand-a; Literature, 1893, Nirnayasagar Press , Mumbai, 484 pages. Barcode 5010010092143   Scan available.

1622. Kaavyamaalaa Ashht'amoguchchhakan  durgaiprasaadena; Language. Linguistics. Literature, 1891, Nirnaya sagara Press, Bombay, 174 pages. Barcode 5010010032900   Scan not available.

1623. Kaavyamaalaa Dashamoguchchhakan  durgaiprasaadena; Language. Linguistics. Literature, 1903, Tukaram Javaji,Bombay, 238 pages. Barcode 5010010032876   Scan not available.

1624. Kaavyamaalaa Da~tiiyao Guchchhaka  Dura~gaaprasada~ Pand-d'ita; Technology, 1932, Nira~naya Saagaraa vyayantraalaye, 172 pages. Barcode 2030020016541   Scan not available.

1625. Kaavyamaalaa Dvadasho Guchchhaka  Durgaprasada~ Pandita~; Geography. Biography. History, 1938, Nira~naya Saagara~ Presa~, 207 pages. Barcode 2030020016450   Scan not available.

1626. Kaavyamaalaa Haravijayamu  shriiratnaakara; Language. Linguistics. Literature, 999, Not available, 712 pages. Barcode 5010010032842   Scan not available.

1627. Kaavyamaalaa Navamoguchchhakan  durgaiprasaadena; Language. Linguistics. Literature, 1893, Tukaram Javaji,Bombay, 165 pages. Barcode 5010010032861   Scan not available.

1628. Kaavyamaalaa Part X  shivad'at't'a; LANGUAGE. LINGUISTICS. LITERATURE, 1894, Nirnaya Sagar Press , Bombay, 235 pages. Barcode 5010010042539   Scan not available.

1629. kaavyamaalaa san'grah  pand-d'ita durgaa prasaada; Literature, 1827, Nirnayasagar Press , Mumbai, 167 pages. Barcode 5010010092136   Scan available.

1630. Kaavyamaalaa Saptamo Guchchhaka  Shriimaanatung-gaachaaraya; Language. Linguistics. Literature, 1926, Nira~nd-ayasaagara Mudrand-ayan'traalaye, 176 pages. Barcode 2030020015975   Scan not available.

1631. Kaavyamaalaa Shashht'ho Guchchhaka  Durgaprasada~ Pandita~; Geography. Biography. History, 1930, Nira~naya Saagara~ Presa~, 175 pages. Barcode 2030020016449   Scan not available.

1632. kaavyamaalaa1  pand-itatrajalaalasununaa; Literature, 1886, Nirnayasagar Press , Mumbai, 330 pages. Barcode 5010010091943   Scan available.

1633. kaavyamaalaa11  kasinatha panduranga paraba; Religion, 1895, Nirnaya Sagar Press, Bombay, 334 pages. Barcode 5010010087199   Scan not available.

1634. kaavyamaalaa12  kasinatha panduranga paraba; Religion, 1887, Nirnaya Sagar Press, Bombay, 159 pages. Barcode 5010010087236   Scan not available.

1635. kaavyamaalaa16  kasipati; Religion, 1889, Nirnaya Sagar Press, Bombay, 84 pages. Barcode 5010010087220   Scan not available.

1636. kaavyamaalaa3  kasinatha panduranga paraba; Religion, 1887, Nirnaya Sagar Press, Bombay, 397 pages. Barcode 5010010087193   Scan not available.

1637. Kaavyamiimaan'saa  Raajashekhara Kaviraaja; Technology, 1934, Vidya Vilaasa Presa~, 363 pages. Barcode 2030020016521   Scan not available.

1638. Kaavyamiimaan'saa Aalochanaa Nibandha  Raajashekhara Kaviraajaa; Social Sciences, 1954, Jyotishha Prakaasha Presa~, 376 pages. Barcode 2030020016316   Scan not available.

1639. Kaavyamiimaan'saa Prathama San'skarand-ama~  Raajashekhara Kaviraajaa; Language. Linguistics. Literature, 1954, Biihaara~ Rashhatra Bhaashhaa Parishhada, 377 pages. Barcode 2030020015986   Scan not available.

1640. kaavyapradiipa  durgaaprasaadena; Literature, 1899, Nirnayasagar Press , Mumbai, 499 pages. Barcode 5010010091966   Scan available.

1641. Kaavyapradiipa  mahaamahopaadhyaayashriigovinda; Language. Linguistics. Literature, 1812, Not available, 502 pages. Barcode 5010010024607   Scan not available.

1642. kaavyapradiipah  pand-itatrajalaalasununaa; Literature, 1891, Nirnayasagar Press , Mumbai, 500 pages. Barcode 5010010091994   Scan available.

1643. Kaavyaprakaasha  Not available; Language. Linguistics. Literature, 0, Not available, 524 pages. Barcode 5010010026007   Scan not available.

1644. Kaavyaprakaasha Kaavyaprakaashavistaarakaaravyayaa Vyaakhyaaya Vibhuushhita  mammat'aachaarya; Language. Linguistics. Literature, 1976, sampurnaanand sanskrit vishvavidyalaya, varanasi, 280 pages. Barcode 5010010026008   Scan not available.

1645. Kaavyaprakaasha Krxtayaa Vivrxtti  mammat'a; Language. Linguistics. Literature, 1980, motilaala banaarasiidasa, dilli, 608 pages. Barcode 5010010026009   Scan not available.

1646. Kaavyaprakaasha Naageshvarii T'iikayaa Samalang-krxta  shriimammat'aachaarya; Language. Linguistics. Literature, 1967, chaukhambhaa san'skrxta san'sthaana, vaaraand-asii, 329 pages. Barcode 5010010026010   Scan not available.

1647. Kaavyaprakaasha Naageshvarii T'iikayaa Samalang-krxta  shriimammat'aachaarya; Language. Linguistics. Literature, 1967, chaukhambhaa san'skrxta san'sthaana, vaaraand-asii, 770 pages. Barcode 5010010028294   Scan not available.

1648. kaavyaprakaashakhand-d'ana  Rasikalal Chotalal Parikh; , 2002, Bharatiya Vidya Bhavan Bombay, 143 pages. Barcode 5010010007109   Scan not available.

1649. Kaavyaprakaashakhand-d'ana  Siddhichandragand-i; Language. Linguistics. Literature, 1953, Sin'ghijainashaastrashiqs-aapiit'ha, 156 pages. Barcode 2030020016547   Scan not available.

1650. Kaavyaratnan  Ara~hadhaasii; Language. Linguistics. Literature, 1931, Raajakiiyamudrand-aalayan', 108 pages. Barcode 2030020016519   Scan not available.

1651. Kaavyasaarasan'graha  Not Available; LANGUAGE. LINGUISTICS. LITERATURE, 0, Motilal Banarsidass , Delhi, 329 pages. Barcode 5010010042550   Scan not available.

1652. Kaavyashilpamu  vinnakoot'a maadhava raavu; Language. Linguistics. Literature, 0, Mumukshuvu Press, Eluru, 372 pages. Barcode 5010010028295   Scan not available.

1653. kaavyonmoshhan  Harishchandra Renupurakar; Poems, 1986, Bharatiya Vidya Bhavan Mumbai, 224 pages. Barcode 5010010001121   Server error, availability unknown.

1654. Kaayaparishuddhi  Shaastrii Shriivasudeva; Philosophy. Psychology, 1939, Aanandaashramamudrand-aalayan', 140 pages. Barcode 2030020016485   Scan not available.

1655. Kabeer Manshur  Sri Paramanandaji; Unknown, 999, Gangavishnu_Srikrishna_Das, 1394 pages. Barcode 2020010005546   Scan available.

1656. Kadaliimanj-junaathamaahaatmyamuu  bhaaradvaja; Religion. Theology, 0, Not available, 477 pages. Barcode 5010010017739   Scan not available.

1657. Kadambari  banabhatta; Language. Linguistics. Literature, 1932, pandurang jawaji bombay, 616 pages. Barcode 2020050057981   Scan not available.

1658. Kadambari - Purva Bagha  Kasinatha Panduranga Parab; Literature, 999, , 606 pages. Barcode 5010010001038   Scan not available.

1659. Kadambari Kalyanam  narasimhakavi; Language. Linguistics. Literature, 1936, the educational publishing company madras, 268 pages. Barcode 2020050057975   Scan not available.

1660. Kadhambari  -; Language. Linguistics. Literature, 1963, the chwkhamba sanskrit series office, 166 pages. Barcode 2020050036039   Scan not available.

1661. Kadhambari Purvabaga Part 2  -; Unknown, 1952, Samskrita_Sahithya_Sadana, 126 pages. Barcode 2020010005556   Scan available.

1662. Kai Govin'dasuta Ura~fa Parushuraama Govin'da Chin'chaalakara  Parushuraamachin'chaalakara Dattatraya; Geography. Biography. History, 1935, Aatmaaraama chapa~khaanaa, 160 pages. Barcode 2030020016389   Scan not available.

1663. Kaing-karyaratnaavali  paravastukrxshhnd-amaachaarya; Language. Linguistics. Literature, 1993, kahaanii kaariyaalaya, 280 pages. Barcode 5010010012383   Scan not available.

1664. Kainkaryaratnavali  Sreemannarayanamurthy; Literature, 1993, S.V.U. Oriental Research Institute Tirupati, 282 pages. Barcode 5010010001042   Scan not available.

1665. Kainkaryaratnavali Of Paravastu Krsnamacaharya  Dr M Srimannarayana Murti; Unknown, 1993, ORIENTAL RESEARCH INSTITUTE, 280 pages. Barcode 2020010005564   Scan available.

1666. kaishhiitakibraahmanand-opanishhata  koovela; Religion, 1861, Baptist Mission Press, Calcutta, 201 pages. Barcode 5010010087210   Scan not available.

1667. Kakolutikeeyamu  Sri Vishnu Sharma; Unknown, 1955, Chaukamba_Vidhya_Bhavan, 114 pages. Barcode 2020010005566   Scan available.

1668. Kala Madhav  Madhava Charya; Linguistics Literature, 1937, , 240 pages. Barcode 5010010001046   Scan not available.

1669. kalaamaadhavaa  Chandrakanth; Natural Sciences, 1838, Kalyan Mumbai, 311 pages. Barcode 5010010005137   Server error, availability unknown.

1670. Kalaamruthamu  -; Unknown, 1958, vavilla ramaswamy sastrulu and sons, 290 pages. Barcode 2020010005567   Scan available.

1671. Kalapasuutramu  Sri Krupa Chanda; Unknown, 1939, Nirnaya Sagar Press,Mumbai, 631 pages. Barcode 5010010010788   Scan not available.

1672. Kalapoornoday  S Suryanarayan Shastry; Unknown, 1972, DAKSHIN BHARATH PRESS, 212 pages. Barcode 2020010005580   Scan available.

1673. Kalapurnodaya  suryanarayana sastri; Language. Linguistics. Literature, 1968, andhra pradesh sahitya akademi hyderabad, 244 pages. Barcode 2020050036086   Scan not available.

1674. Kalatattvakosa  kapila vatsyayan; Unknown, 1992, indiragandhi national centre for the arts, 510 pages. Barcode 2020010005590   Scan available.

1675. Kalidasa Sahitya Evam Vadana Kala  Dr Sushma Kulshreshtha; Unknown, 1986, EASTERV BOOK LINKERS, 300 pages. Barcode 2020010005600   Scan available.

1676. Kalidasa Vol Ii  K S Rama Swami Sastri; Unknown, 999, SRI VANI VILAS PRESS, 352 pages. Barcode 2020010005602   Scan available.

1677. Kalidasa's Kumarasambhavam (Cantos I-vii)  S.r.sehgal; Unknown, 1959, Oriental_Booksellers_ _Publishers, 254 pages. Barcode 2020010005601   Scan not available.

1678. Kalpa Kalkika  Harihara Kripala Dwivedi; Linguistics Literature, 999, Banik Press Calcutta, 715 pages. Barcode 5010010001051   Scan not available.

1679. Kalpadrukosa Of Kesava Vol I  Ramavatara Sarma; Unknown, 1928, Oriental_Institute, 564 pages. Barcode 2020010005614   Scan available.

1680. Kalpadrukosa Of Kesava Vol I I  Srikanth Sharma; Unknown, 1932, Oriental_Institute, 302 pages. Barcode 2020010005613   Scan available.

1681. Kalpadrukosha Da~vitiiya Bhaaga  Kesava; Language. Linguistics. Literature, 1932, Gavara~nament'a Presa~, 307 pages. Barcode 2030020016505   Scan not available.

1682. Kalpadrukosha Vol Ii  keshava; LANGUAGE. LINGUISTICS. LITERATURE, 1932, Oriental Institute , Baroda, 299 pages. Barcode 5010010042547   Scan not available.

1683. Kalpalataviveka By An Anonymous Author  Murari Lal Nagar; Unknown, 1958, Lalbhai_Dalpatbhai_Bharatiya_Sanskriti_Vidyamandira_Ahmedabad-9, 528 pages. Barcode 2020010005615   Scan available.

1684. Kalpasutra(subhodhika Vyakya)  Unknown; Religion. Theology, 999, Unknown, 395 pages. Barcode 5010010010787   Scan not available.

1685. Kalyaanamaalla Anan'garan'gama~  Kalyaanamaalla Mahaakavi; Technology, 1927, Pan'jaaba san'skrxta Pustakaalaya Laahora~, 112 pages. Barcode 2030020016474   Scan not available.

1686. Kalyaand-apiiyuushhavyaakhyaasametaa Pan'chadashii Tattvavivekaprakarand-amu  Not available; Language. Linguistics. Literature, 0, Not available, 584 pages. Barcode 5010010024618   Scan not available.

1687. kalyaand-avaartikamuusiddhaantaniddddaana  K.g. Natosa sastri; Technology, 1932, Orient Publicti Company Madras, 178 pages. Barcode 5010010026472   Scan not available.

1688. Kalyan  -; Unknown, 999, -, 1175 pages. Barcode 2020010005633   Scan available.

1689. Kalyan Ank  Hanumanprasad Pohar; Unknown, 999, Geetha_Press, 900 pages. Barcode 2020010005626   Scan available.

1690. Kalyan Markandeya Puranam  -; Unknown, 999, -, 782 pages. Barcode 2020010005631   Scan available.

1691. Kalyan Sankhya-i  Hanuman Prasad; Unknown, 999, Mothilal Press, 760 pages. Barcode 2020010011981   Server error, availability unknown.

1692. Kalyan Sanshikpt Skand Puranam  Hanuman Prasad Pothar; Unknown, 999, Geetha_Press, 906 pages. Barcode 2020010005632   Scan available.

1693. Kalyana Sancheka  -; Unknown, 1952, SRI RAMA BOOK DEPO., 90 pages. Barcode 2020010005627   Scan available.

1694. kamaikaarad'akramaavalii  Somashambhu; , 1947, THE KRISHNA PRINING PRESS KASHMIR, 207 pages. Barcode 5010010007089   Scan not available.

1695. Kamakalavilas  punyananda; Language. Linguistics. Literature, 1918, tatva vivechaka press, bombay, 60 pages. Barcode 5010010024748   Scan not available.

1696. Kamakunjalata  Panditraj Dhunddhiraja Sastri; Unknown, 1967, THE CHOWKHAMBA SANSKRIT SERIES OFFICE, 306 pages. Barcode 2020010005636   Scan available.

1697. Kamalavilasabhana  Narayana Kavi; Linguistics Literature, 1971, S.V.U. Oriental Research Institute Tirupati, 30 pages. Barcode 5010010001052   Scan not available.

1698. Kamaliniikalahasamuu  sri rajachudamani dikshita; LANGUAGE. LINGUISTICS. LITERATURE, 1917, sri vani vilas press, srirangam, 100 pages. Barcode 5010010078280   Scan available.

1699. Kanadasiddaantachandrika  t'i gand-apati saastri; Language. Linguistics. Literature, 1913, Travancore Government Press, Trivandrum, 80 pages. Barcode 5010010024619   Scan not available.

1700. Kanakaavalii  naaraayand-aacharya; Language. Linguistics. Literature, 0, adyar library and research center, madras, 39 pages. Barcode 5010010028296   Scan not available.

1701. Kand-aisundarii  shriibihand-a; Language. Linguistics. Literature, 1895, Tukaram Javaji,Bombay, 68 pages. Barcode 5010010032907   Scan not available.

1702. Kaniviya Anthyashti Padhathi  Badlikar Sriyeag Raghavrisurisununa; Unknown, 999, Kale Ithupahavbhikajipantain, 140 pages. Barcode 2020010005655   Scan available.

1703. Kanva Sanhita  Bhattacharyen Sripad Sharmana Damodar Bhattsununa; Unknown, 999, Vasanth Sripad Satvalekar, 240 pages. Barcode 2020010005672   Scan available.

1704. Kanva Sanhitha  Krishna Das Gupta; Unknown, 1915, VIDYA VILAS PRESS BENNARAS, 674 pages. Barcode 5010010001059   Scan not available.

1705. Kanya Sanhitha Of The Shukla Yajurveda  Madhava Shastri; Unknown, 1915, H_D_Gupta sons, 462 pages. Barcode 2020010005673   Scan available.

1706. Kapiinaamupavaasa  r rajarajavarma; LANGUAGE. LINGUISTICS. LITERATURE, 1913, Not Available, 12 pages. Barcode 5010010080055   Scan available.

1707. Kapphinabhyudaya  Gauri Shankar; Unknown, 1937, The_University_Of_The_Panjab, 294 pages. Barcode 2020010005677   Scan available.

1708. Kar^mapradiipa  Not Available; Social Sciences, 999, Not Available, 296 pages. Barcode 5010010033822   Scan not available.

1709. Karak Darshanamu  Sri Kalanath Jha; Unknown, 1969, CHOUKHAMBA VIDYABHAVAN VARANASI, 216 pages. Barcode 2020010012011   Server error, availability unknown.

1710. Karaka Mimamsa  Motilal Joshi; Linguistics Literature, 2001, Rajasthan_Sanskrit_Sahitya_Sammelan,Jayapur, 268 pages. Barcode 5010010001066   Scan not available.

1711. Karakan'd'achariu  Kanakaamara Munii; Language. Linguistics. Literature, 1934, Gopaala Ambaadaasa Chavare, 370 pages. Barcode 2030020015984   Scan not available.

1712. Karana Kutuhalam Of Sri Bhaskaracharya  Dr.satyendra Mishra; Indian Astrology, 1991, Krishnadas_Academy,Varanasi, 176 pages. Barcode 5010010001067   Scan not available.

1713. Karanaprakasa  Brahmadeva; Unknown, 1899, Chowkhamba_Sanskrit_Book_Depot, 100 pages. Barcode 2020010005678   Scan available.

1714. Karand-aratnamu Subodhinii Samaakhyavyaakhyaaya  topalli ven'kat'araamadaivagn-ena; Language. Linguistics. Literature, 1918, vishaakhapat't'and-a aarshhamudraashaala, 184 pages. Barcode 5010010028297   Scan not available.

1715. Kara~maviira Bhaauuraava Paat'iila Charitra Va Kara~ya  Ghorapad'e Ekanatha Keshavarava; Geography. Biography. History, 1942, Ga Ma Nalaavad'e Naaraayand-a chhaapakhaanaa, 231 pages. Barcode 2030020016296   Scan not available.

1716. Karmakanda Karmavali  Sri Somashambhu; Unknown, 1947, The Krishna Printing Press, 212 pages. Barcode 2020010005682   Scan available.

1717. Karmakanda Kramavali No Lxxiii  Somasnambhu; Indian Astrology, 1947, The Krishna Printing Press Kashmir, 207 pages. Barcode 5010010001069   Scan not available.

1718. Karnasundari  bilhana; Language. Linguistics. Literature, 1932, pandurang jawaji bombay, 78 pages. Barcode 2020050057970   Scan not available.

1719. Karnd-aamrxta Prapaa  bhat't'a someshvara; Language. Linguistics. Literature, 1963, raajasthaana praachyavidhyaa pratishht'haana, jodhpuuru, 54 pages. Barcode 5010010028298   Scan not available.

1720. Karnd-akutuhala  puraatattvaachaarya jinavijaya muni; Language. Linguistics. Literature, 0, Rajasthan Oriental Research Institute , Jaipur ., 61 pages. Barcode 5010010012635   Scan not available.

1721. karpuuramajjarii  pand-itavrajalaalasuununaa; Literature, 1900, Nirnayasagar Press , Mumbai, 330 pages. Barcode 5010010091995   Scan available.

1722. Kartika Masa Mahatmyam  Bapuharshet Devalekar; Unknown, 999, Bapuharshet_Devalekar Mumbai, 148 pages. Barcode 5010010001079   Scan not available.

1723. Karupuramanjari Edition Ii  Manomohan Ghosh; Unknown, 1948, THE UNIVERSITY OF CALCUTTA, 192 pages. Barcode 2020010005696   Scan available.

1724. Kasaya Pahudam Iii Thidi Vihatti  Gunabhadracharya; Unknown, 1955, The_Secretary_Publication_Department_The_All_India_Digmbar_Jain_Sangha, 558 pages. Barcode 2020010005697   Scan available.

1725. Kashika Part 3  Vamana; Unknown, 1976, Sanskrit_Academy, 412 pages. Barcode 2020010005702   Scan available.

1726. Kashyagnanakandah  Parthasaradhi Bhattarcharya; Unknown, 1860, T.T.D Tirupati, 234 pages. Barcode 2020010005710   Scan available.

1727. Kashyapajnana Khandah  Pardha Saradhi Battacharya; Unknown, 1960, T.T.D Tirupati, 240 pages. Barcode 2020010005711   Scan available.

1728. Kashyapashilpama~  Kashyapa Mahaara~shhi; The Arts, 1926, Aanandaashramamudrand-alayan', 313 pages. Barcode 2030020016428   Scan not available.

1729. Kashyapgyaankanda  R.b.patrusarthi Bhatta Charya; Unknown, 1960, T.T.D Tirupati, 234 pages. Barcode 2020010005712   Scan available.

1730. Kasika Part 1  Vamana And Jayaditya; Unknown, 1969, Sanskrit_Academy, 486 pages. Barcode 2020010005713   Scan available.

1731. Kasyapa - Jnan kanda  Rarthasarathi Bhattachar R; Unknown, 1948, T.T.D Tirupati, 211 pages. Barcode 5010010001093   Scan not available.

1732. Kasyapa Gnanakandaha  Parthasarathy Battacharya. R.b; Literature, 1960, T.T.D Tirupati, 230 pages. Barcode 5010010001090   Scan not available.

1733. Kasyapa Jnanakanda  Kasyapa Maharshi; Religion, 1998, T.T.D Tirupati, 236 pages. Barcode 5010010001092   Scan not available.

1734. Kasyapa Samhita  Rarthasarathi Bhattachar,r; Unknown, 1948, T.T.D Tirupati, 624 pages. Barcode 5010010001094   Scan not available.

1735. kat'aakshhashatakam  vibhuuka; Literature, 1911, Sri Vanivilas Press, 30 pages. Barcode 5010010092155   Scan available.

1736. Kat'hakagrxhyasuutran' Bhaashhyatrayasaarayutan  Dr. Willem Caland; Language. Linguistics. Literature, 1925, Dayanand Mahavidyalaya Sanskrit Series Publication, 344 pages. Barcode 5010010029060   Scan not available.

1737. Kat'hopaanishhada~ Aavrxtti Pahilii  Bhin'de Sadaashivashaastrii; Religion. Theology, 1930, Gajaanana Vishvanaatha Ketakara, 266 pages. Barcode 2030020016401   Scan not available.

1738. Katakarajavamsavali Vol I  Dr Gaya Charan Tripathi; Unknown, 1987, VOHRA PUBLISHERS DISTRIBUTORS, 142 pages. Barcode 2020010005720   Scan not available.

1739. Katha Kagruha Suthra  William Caland; Linguistics Literature, 1925, , 339 pages. Barcode 5010010001096   Scan not available.

1740. Katha Sarithsagara  Somadeva; Unknown, 1959, The_Sanskrit_Academy, 122 pages. Barcode 2020010005740   Scan available.

1741. Kathaakallolini Paand-iniiyalaukikavyaakarand-asamaapaniiyaa  raamasharand-ashaastrii; Language. Linguistics. Literature, 1961, chaukhambaa vidhyaabhavana vaaraand-asii, 396 pages. Barcode 5010010024636   Scan not available.

1742. Kathaka Upanishad  swami satchidanandendra saraswathi; Language. Linguistics. Literature, 1885, adhyatma prakasha karyalaya,holenarsipur, 190 pages. Barcode 5010010017939   Scan not available.

1743. Kathaka Vyasatirtheeya Teeka,vedeshiya Teeka,manduka Vyasatirtheeya,srinivasa Tirtheeya Etc  T.r.krishnacharya; Unknown, 1904, T.R.Krishnacharya,Kumbhakonam, 378 pages. Barcode 5010010001097   Scan not available.

1744. Kathakagrhyasutram  Dr.willem Caland; Unknown, 1925, Dayanand Mahavidhyalay Sanskrit Grandhmala, 344 pages. Barcode 2020010005721   Scan available.

1745. Kathamruthamu  Rambalak Shastri; Unknown, 999, Motilal_Banarassi_Dass, 84 pages. Barcode 2020010005727   Scan available.

1746. Kathasaritsagara Part 2  S V Shastri; Unknown, 1965, The_Sanskrit_Academy, 220 pages. Barcode 2020010005741   Scan available.

1747. Kathopanisad Bhasya  K C Varadachari; Unknown, 1979, P_V_R_K_Prasad, 240 pages. Barcode 2020010005746   Scan available.

1748. Katiyeshti Dipaka  M.m.p.nitya Nanda Parvatiya; Unknown, 1924, Jai_Krishna_Dass_Gupta, 114 pages. Barcode 2020010005747   Scan available.

1749. Katyayana And Patanjali Edition Ii  F Keilhorn; Unknown, 1963, INDOLOGICAL BOOK HOUSE, 62 pages. Barcode 2020010005753   Scan available.

1750. Kaumarabhrityam With Navya Balaroga  raghuveera prasad trivedi; Technology, 1966, chowkhamba sanskrit series office varnasi, 512 pages. Barcode 2020050036348   Scan not available.

1751. Kaumudi Mahotsava  Sakuntal Rao Sastri; Unknown, 1952, -, 222 pages. Barcode 2020010005754   Scan available.

1752. Kaumudiisharadaagamamu Dvitiiya Bhaagamu  vikrama deiva varma; Language. Linguistics. Literature, 1942, Sri Vijayanagara Maharaja Samskruta Kalashala, Vijaya Nagaramu, 480 pages. Barcode 5010010028195   Scan not available.

1753. Kaun'shhiitakagrxhya Suutraand-i  t'i ara chintaamani; Language. Linguistics. Literature, 1944, University Of Madras , Chennai ., 322 pages. Barcode 5010010012690   Scan not available.

1754. Kaushhiitakagrxhyasutraand-i  Chintaamand-i Ti Ra; Religion. Theology, 1944, Andhraa Presa Madraasa~, 330 pages. Barcode 2030020016271   Scan not available.

1755. Kaushhiitaki Braahmand-opanishhatu Diipikaa  shang-karaananda; Language. Linguistics. Literature, 1968, chaukambaa san'skrxta siriija aaphiisa vaaraand-aasii, 204 pages. Barcode 5010010028285   Scan not available.

1756. kaut'iliiyam' ar^thashaastram'  Kautilya; SOCIAL SCIENCES, 1924, Sri Shama Sastry, 500 pages. Barcode 5010010033803   Server error, availability unknown.

1757. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiya Khand-d'a  Jolli Je; Social Sciences, 1924, Motilaala Banaarasii Daasa, 342 pages. Barcode 2030020016091   Scan not available.

1758. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiyo Bhaaga  Jollii Je; Social Sciences, 1924, Motilaala Banaarasi Daasa, 338 pages. Barcode 2030020016171   Scan not available.

1759. Kaut'iliiyama~ Ara~tha Shaastrama~ Khand-d'a 1  Jolli Je; Social Sciences, 1923, Motilaala Banaarasii Daasa, 348 pages. Barcode 2030020016095   Scan not available.

1760. Kaut'iliiyan' Ara~tha Shaastrama~  Shaastrii Ra Shamaa; Social Sciences, 1919, Mehara Chan'da Lachamana Daasa, 502 pages. Barcode 2030020016143   Scan not available.

1761. Kautilya Vol I  -; Unknown, 1923, The_Punjab_Sanskrith_Book_Depot, 338 pages. Barcode 2020010005755   Scan available.

1762. Kavalamkara Sara Samgraha  ubhata; Language. Linguistics. Literature, 1925, -, 368 pages. Barcode 2020050058031   Scan not available.

1763. Kavalayananda  T.k ramachandra aiyar; Religion. Theology, 2000, R.S vadhyar and sons, 158 pages. Barcode 2020050017244   Scan available.

1764. Kavayadarsha  sankara rama sastry c; Language. Linguistics. Literature, 1942, the balamanorama press madras, 140 pages. Barcode 2020050057994   Scan not available.

1765. Kaviindraacharyasuchi Patramu  aar.anann'ta krishhana saastri; Language. Linguistics. Literature, 1921, Central Library, Baroda, 57 pages. Barcode 5010010024640   Scan not available.

1766. Kavikalapadruma Of Vopadeva  Gajanan Balkrishna Pa sule; Unknown, 1954, Poona, 142 pages. Barcode 2020010005759   Scan available.

1767. Kavikalpadruma Prathama San'skarand-ama~  Shriivopadevagosvaamii; Language. Linguistics. Literature, 1904, Pand-d'ita Shrii Ashubodha Vidhyaabhushhand-a, 260 pages. Barcode 2030020015994   Scan not available.

1768. kavikalpalataa  Sarat Chandra Sastry; Literature, 1913, Asiatic Society Kolkata, 194 pages. Barcode 5010010007101   Scan not available.

1769. Kavikalpalataa  mahaakavi shriideveshvara; Language. Linguistics. Literature, 1895, kalikataanagaryyamu siddheshvarayantre, 104 pages. Barcode 5010010025866   Scan not available.

1770. Kavimanoranjakachampu  siitaaraaamasuuri; Language. Linguistics. Literature, 1950, The University Manuscrifts Library , Trivandrum ., 106 pages. Barcode 5010010012634   Scan not available.

1771. Kavindracandrodaya  Har Dutt Sharma; Unknown, 1939, Orient_Book_Agency, 92 pages. Barcode 2020010005763   Scan available.

1772. Kavindracharya List  R Ananta Krishna Sastry; Unknown, 1921, CENTRAL LIBRARY, 58 pages. Barcode 2020010005764   Scan available.

1773. Kavindravacanasamuccaya  F.w.thomas; Linguistics Literature, 1912, The Asiatic Society Of Bengal calcutta, 386 pages. Barcode 5010010005178   Server error, availability unknown.

1774. Kavya Parisha  Sri Parushuram Sharmana; Unknown, 1956, Mithila_Vidhyapeeth_Pradhanen, 164 pages. Barcode 2020010005796   Scan available.

1775. Kavya Prakash  Pt.girdhar Sharma; Unknown, 1934, Pt.dhanlal_Sharma, 202 pages. Barcode 2020010005798   Scan available.

1776. Kavyadarpana Volume 1  Rajachudamani Dikshita; Language. Linguistics. Literature, 0, Sri Vani Vilas Press , Srirangam ., 423 pages. Barcode 5010010012633   Scan not available.

1777. Kavyadarsh  Pandith Rangacharya Raddi Shastry; Unknown, 1938, BHANDAR ORIENTAL RESEARCH INSTITUTE, 466 pages. Barcode 2020010005776   Scan available.

1778. Kavyadeepika  Pandith Sri Ram Govind Shukla; Unknown, 1951, Chowkhamba_Sanskrith_Series_Office, 210 pages. Barcode 2020010005777   Scan available.

1779. Kavyakotukadarsh  Dr Ram Gopal Mishra; Unknown, 1984, Viveka_Prakashana, 172 pages. Barcode 2020010005781   Scan available.

1780. Kavyalaksana Of Dandin  ananthalal thakur; Unknown, 1957, mithila insitute of post graduate studies and research in sanskrit learning, 356 pages. Barcode 2020010005782   Scan available.

1781. Kavyalamkarasutravritti Of Vamana  Narayan Nathaji Kaulkarni; Unknown, 1927, ORIENTAL BOOK AGENCY, 108 pages. Barcode 2020010005783   Scan available.

1782. Kavyalankara Sara Sangraha  Banhatti. N.d; , 1925, Miraj, 359 pages. Barcode 5010010007105   Scan not available.

1783. Kavyalankarasutrani Vol I V  Narayan Ram Acharya; Unknown, 1956, Nirnay_Sagar_Press, 124 pages. Barcode 2020010005785   Scan available.

1784. Kavyamala  pandit durgaprasada ed; Language. Linguistics. Literature, 1911, tukuram javaji, 174 pages. Barcode 2020050036046   Scan not available.

1785. Kavyamala  Narayana Daso Banahatti; Kavyalankara, 1938, PANDURANG JAWAJI PROPRIETOR NIRNAYA SAGAR PRESS,BOMBAY, 176 pages. Barcode 5010010001114   Scan not available.

1786. Kavyamala Part 1  Pandit Durga Prasad; Unknown, 1929, Panduranga_Jawaji, 174 pages. Barcode 2020010005788   Scan available.

1787. Kavyamala Part 13  Durgaprasad; Unknown, 1916, Tukaram_Jawaji, 180 pages. Barcode 2020010005787   Scan available.

1788. Kavyamala Part 5  Kasinath Panduranga Parab; Unknown, 1937, Pandit_Panduranga_Jawaji, 190 pages. Barcode 2020010005790   Scan available.

1789. Kavyamala Part I X  Mahamahopadhyaya Pandith Shivadatta; Unknown, 1916, Tukaram_Javaji, 166 pages. Barcode 2020010005792   Scan available.

1790. kavyamala23  kasinatha panduranga paraba; Religion, 1891, Nirnaya Sagar Press, Bombay, 467 pages. Barcode 5010010087179   Scan not available.

1791. Kavyamrtam  Sreeramamurthy; Kavyalankara, 1938, S.V.U. Oriental Research Institute Tirupati, 140 pages. Barcode 5010010001117   Scan not available.

1792. Kavyanusasana  acharya hemachandra; Language. Linguistics. Literature, 1964, shri mahaveera jain vidyalaya bombay, 730 pages. Barcode 2020050058027   Scan not available.

1793. Kavyanusasana  Pandit Sivadatta; Kavyalankara, 1934, Nirnaya Sagar Bombay, 449 pages. Barcode 5010010001118   Scan not available.

1794. Kavyanusasana Vol I  Acharya Hemachandra; Unknown, 1938, Sri_Mahavira_Jaina_Vidyalaya, 626 pages. Barcode 2020010005794   Scan available.

1795. Kavyaprakasa of Acharya Mammata  Sri Harishankara Sarama; Unknown, 2003, Chaukhambha _Sanskrit_ Sansthan, 327 pages. Barcode 2020010012085   Server error, availability unknown.

1796. Kavyaprakash  Hari Narayan Aapte; Unknown, 1866, ANANDA SHRAM MUDRANALAY, 646 pages. Barcode 2020010005797   Scan available.

1797. kavyaprakash Rahasyam  Pt.seetharam Jayramjoshi; Unknown, 1987, CHOUKHAMBA SANSKRIT SERIES OFFICE,VARANASI, 185 pages. Barcode 2020010012087   Server error, availability unknown.

1798. Kavyasamudaya  Sri Venkataramanarya; Poems, 1944, Sri Venkataramanarya, 275 pages. Barcode 5010010001119   Scan not available.

1799. Kavyasangraha 3  Jivananda vidyasagar Bhattacharya; Poems, 1992, Reprintographics,Delhi, 538 pages. Barcode 5010010001120   Scan not available.

1800. Keinchuifantsan  -; Unknown, 1992, Motilal Banarsidass Publishers, 232 pages. Barcode 2020010005810   Scan available.

1801. keivalyaratnamuu  Vasudeva Jnana Muni; Philosophy. Psychology, 0, Not Available, 152 pages. Barcode 5010010026471   Scan not available.

1802. Kelikutuuhale Prathamastarang-ga  Not available; Language. Linguistics. Literature, 0, Not available, 98 pages. Barcode 5010010025867   Scan not available.

1803. Kemopanished  Pandit. Sridhar Shastri; Unknown, 1919, Oriental Book Suppling Agency Poona City, 112 pages. Barcode 5010010001126   Scan not available.

1804. Kenoo Upanishad  swami satchidanandendra saraswathi; Language. Linguistics. Literature, 1881, adhyatma prakasha karyalaya, holenarsipur, 133 pages. Barcode 5010010017940   Scan not available.

1805. Kenopanishad Bhashya  rangaraamanuja; Religion. Theology, 1956, S.V.U. Oriental Research Institute Tirupati, 62 pages. Barcode 2020050057956   Scan not available.

1806. kenopanishhat  chin'taamand-a gan'gaadhara bhaanu; Literature, 1912, Induprakash Press , Mumbai, 278 pages. Barcode 5010010092081   Scan available.

1807. Kenopanishhata~  Machchhakad'araachaara~ya; Religion. Theology, 1919, Orien't'ala Buka Saplaain'ga Ejandsii, 123 pages. Barcode 2030020016079   Scan not available.

1808. Kenopanishhata~ Shhashht'hiiya Khand-d'a Grantha 6  Naaraayand-a; Religion. Theology, 1934, Aanandaashramamudrand-aalaye, 117 pages. Barcode 2030020016187   Scan not available.

1809. Keralodaya (a Historical Poem)  K.n.ezhuthachan; Unknown, 1977, Printed_By_The_Bharat_Printers,, 510 pages. Barcode 2020010005812   Scan available.

1810. Keshava Saahitya Mein' Samaaja San'skrxti Evn' Darshan  d'aa en gn-aanappa naayud'u; Language. Linguistics. Literature, 1978, shrii ven'kat'eshvaraa vishvavidyalaya, 402 pages. Barcode 5010010012490   Scan not available.

1811. Kevalanavyiprakarnaam  Ganeshopadhyay; Unknown, 999, MOTILAL BANARSIDAS, 332 pages. Barcode 2020010005815   Scan available.

1812. Khaadiragrxhyasutrama~  Shriipat't'abhiramachara~ya; Religion. Theology, 1955, Shrii Vaanii Vilasa~ Presa~, 230 pages. Barcode 2030020016496   Scan not available.

1813. Khaadiragrxhyasuutramu Vyaakhyaayasahitamu  rudraskanda; Language. Linguistics. Literature, 1913, government branch press, mysore, 217 pages. Barcode 5010010024645   Scan not available.

1814. Khaadiragrxhyasuutramu Vyaakhyaayasahitamu  rudraskanda; Language. Linguistics. Literature, 1913, government branch press, mysore, 184 pages. Barcode 5010010025868   Scan not available.

1815. Khaadiragrxhyasuutramu Vyaakhyaayasahitamu  rudraskanda; Language. Linguistics. Literature, 1913, government branch press, mysore, 217 pages. Barcode 5010010028286   Scan not available.

1816. Khaadiragrxhyasuutrn' Rudraskandavyaakhyaasahitan  A. Mahadeva Sastri; Language. Linguistics. Literature, 1913, Government Oriental Library, Mysore, 180 pages. Barcode 5010010029076   Scan not available.

1817. Khand-anakhand-akhaadhamu  chan'd'iiprasaada sukla; Language. Linguistics. Literature, 0, achyutagranthamaalaakaaryaalaya, kaashii, 428 pages. Barcode 5010010028287   Scan not available.

1818. Khand-d'anakhand-d'akhaadhyamu  shriishriiharshha; Language. Linguistics. Literature, 1936, Not available, 100 pages. Barcode 5010010024647   Scan not available.

1819. khand-d'anakhand-d'akhaadya Part 1  G. Jha; Philosophy. Psychology, 0, Not Available, 642 pages. Barcode 5010010026470   Scan not available.

1820. Khanda Kadya Sahastrika  Arka Somayaji; Unknown, 1959, Arka_Somayaji, 224 pages. Barcode 2020010005817   Scan available.

1821. khilaadhikaaran' bugusan'hitaa  Bhrugu Maharshi; Samhita, 1997, T.T.D Tirupati, 586 pages. Barcode 5010010007115   Scan not available.

1822. Khiladikara  Pandit R.b.pathrusarthi Bhatta Charya; Unknown, 1962, Chaukhamba Surbharati Prakashan, 576 pages. Barcode 2020010005821   Scan available.

1823. Khilandhikara  Pardha Saradhi Battacharya; Unknown, 1951, T.T.D Tirupati, 582 pages. Barcode 2020010005822   Scan available.

1824. Kiichakavadhama~  Nitiivara~ma Mahaakavi; Language. Linguistics. Literature, 1929, Da In'd'iyana~ Presa~, 191 pages. Barcode 2030020016434   Scan not available.

1825. Kiirasandeshah  Laqs-mikaantasyaa jii; Philosophy. Psychology, 1952, Kamara~shiyala~ Print'in'ga~ Presa~, 43 pages. Barcode 2030020016284   Scan not available.

1826. kinkind-ii maalaa  Mahalinga Sastry.y; Literature, 1934, Y Mahalinga Sastry Chidambaram, 125 pages. Barcode 5010010007116   Scan not available.

1827. Kiraataarjunaayamu  bhaaravi; Language. Linguistics. Literature, 1917, Nirnaya Sagar Press, Bombay, 248 pages. Barcode 5010010025869   Scan not available.

1828. kiraataarjuniiyam  ven'kat'raamaatmajena shriinivaasasharmand-a; Literature, 1835, Nirnayasagar Press , Mumbai, 298 pages. Barcode 5010010092176   Scan available.

1829. Kiraataarjuniyamu  bhaaravi; Language. Linguistics. Literature, 1940, jayakrishnadas haridas gupta, 128 pages. Barcode 2020050036400   Scan not available.

1830. Kiranavalirahasyam Of Mathuranatha Tarkavagisha  Srigowrinatha Shastri; Indian Logic, 1981, Sampurnananda Sanskrit University, 203 pages. Barcode 5010010001130   Scan not available.

1831. kiratarjuniya  mallinatha; Religion, 1868, Sangbada Jnanaratnakara Press, Calcutta, 336 pages. Barcode 5010010087194   Scan not available.

1832. Kiratarjuniya 1889  Pandit Durgaprasad; The Arts, 1889, Nirnaya Sagara, 334 pages. Barcode 2020050058021   Scan not available.

1833. Kiratharjuniyam  Dr. Sudhakar malaviya; Unknown, 2002, Krishanadasa_Akadamy, 587 pages. Barcode 2020010012111   Server error, availability unknown.

1834. Kishhkin'dhaa Kaand-d'amuu  kanhaiyaalaala krxshhnd-adaasa; Language. Linguistics. Literature, 1964, shriirameishvara yan'ntraalaya, 204 pages. Barcode 5010010011525   Scan not available.

1835. Kishkindhakandah Of Srimad Ramayanam  -; Unknown, 1951, V_Ramaswamy_Shastrulu_And_Sons, 1166 pages. Barcode 2020010005829   Scan available.

1836. Kiskindhakanda  valmiki; Language. Linguistics. Literature, 1965, oriental institute baroda, 588 pages. Barcode 2020050036058   Scan not available.

1837. Kokasandesa  visnutrata; Language. Linguistics. Literature, 1937, government of travancore, 88 pages. Barcode 2020050036387   Scan not available.

1838. Koushetika Brahmanam Achara Vichara  Dr.madladevi Shastri; Unknown, 1961, Chowkhamba_Vidyabhavan, 70 pages. Barcode 2020010012128   Server error, availability unknown.

1839. kowt'iliiyan' arthaishaastramu  Ganapati Sastri.t; Economics, 1924, GOVT PRESS,TRIVADRUM, 502 pages. Barcode 5010010000376   Server error, availability unknown.

1840. Krama Diipika  kaasmiirika keishava bhat't'a; Language. Linguistics. Literature, 1917, Vidya Vilas Press, Benares, 318 pages. Barcode 5010010028288   Scan not available.

1841. Kramadiipikaa  Bhat't'a Keshava; Religion. Theology, 1917, Jai Krxshhnd-a Daasa Guptaa, 114 pages. Barcode 2030020016032   Scan not available.

1842. Krishhnd-a Yajurveidiya Taitiriiya San'hita  kaashinaatha saastri; Language. Linguistics. Literature, 1905, Ananda Sama Mudranalaya, Poona, 586 pages. Barcode 5010010024656   Scan not available.

1843. Krishhnd-a Yajurveidiya Taitiriiya San'hita  kaashinaatha saastri; Language. Linguistics. Literature, 1905, Ananda Sama Mudranalaya, Poona, 584 pages. Barcode 5010010025216   Scan not available.

1844. Krishna Charitam  Rajvaidya Jivaram Kalidas Shastri; Unknown, 1997, The_Rasashala_Aushadhashram, 57 pages. Barcode 2020010005859   Scan available.

1845. Krishna Charitramu  Peri Venkateswara Shastri; Unknown, 999, Samskrutha_Prachara_Sabha, 74 pages. Barcode 2020010005860   Scan available.

1846. Krishna Vilasa Of Punyakoti With Commentary  Rama Murti.k.s; Religion, 1976, S.V.U. Oriental Research Institute Tirupati, 373 pages. Barcode 5010010001143   Scan not available.

1847. Krishnajuvirdeeya Taitireeysanhitha  Pandith Sripad Damodar Sathvalekar; Unknown, 1983, Swadhyay_Mandal, 478 pages. Barcode 2020010005861   Scan available.

1848. Krithya Kalpataru  K.v. Rangaswami Aiyangar; Religion, 1950, Oriental Institute Baroda, 349 pages. Barcode 5010010001142   Scan not available.

1849. Kriya Svara Laksanam Or Yohi Bhasyam  Suru Bhatta; Unknown, 1983, Sanskrit_Academy, 178 pages. Barcode 2020010005867   Scan available.

1850. kriyaadhikaaran' bugusan'hitaa  Ramanuja Swamy,p.v; Bhrga Samhita, 1953, T.T.D Tirupati, 542 pages. Barcode 5010010007126   Scan not available.

1851. Kriyaasaara Panj-chamaadichaturdashopadeshaanta Dvitiiyobhaaga  shriiniilakand-t'hashivaachaarya; Religion. Theology, 1957, government branch press, mysore, 522 pages. Barcode 5010010024660   Scan not available.

1852. Kriyaasaara Upadeshachatushht'ayaatmaka Prathamo Bhaaga  shriiniilakand-t'hashivaachaarya; Religion. Theology, 1954, government branch press, mysore, 438 pages. Barcode 5010010024662   Scan not available.

1853. Kriyaasaara Upadeshachatushht'ayaatmaka Prathamo Bhaaga  shriiniilakand-t'hashivaachaarya; Religion. Theology, 1954, government branch press, mysore, 434 pages. Barcode 5010010025870   Scan not available.

1854. Kriyaasaara Upadeshachatushht'ayaatmaka Prathamobhaaga  shriiniilakand-t'hashivaachaarya; Language. Linguistics. Literature, 1954, government branch press, mysore, 442 pages. Barcode 5010010024661   Scan not available.

1855. Kriyaasaara Vol I  Shivaa Chara~yaa Niilakan't'ha; Religion. Theology, 1954, Oriental Research Institute Publications, 446 pages. Barcode 2030020016008   Scan not available.

1856. Kriyatmaka Ausadahiparichaya Vijnan  sri vishvanath divedi; Technology, 1966, chowkhamba vidyabhavan varnasi, 294 pages. Barcode 2020050036090   Scan not available.

1857. Krodapattrassangraha Vol II  P. Dhundiraj Shastry Editor; LANGUAGE. LINGUISTICS. LITERATURE, 1923, The Secretary Chowkhamba Sanskrit Series Office Beneras, 101 pages. Barcode 2020050088395   Scan available.

1858. Krsnavilasa Of Punyakoti  Dr. K.s.ramamurti; Unknown, 1976, S.V Oriental Research Institute, 372 pages. Barcode 2020010005870   Scan available.

1859. Krtya Kalpataru Of Bhatta Laksmidhara Danakanda Vol 5  K V Rangaswami Aiyangar; Unknown, 1941, Oriental_Institute, 580 pages. Barcode 2020010005876   Scan available.

1860. Krtyakalapataru Of Bhatta Laksmidhara  k.v. Rangaswami Aiyangar; Unknown, 1942, Oriented Institute, 414 pages. Barcode 2020010005873   Scan available.

1861. Krtyakalapataru Of Bhatta Laksmidhara Vol 1  k.v. Rangaswami Aiyangar; Unknown, 1948, Oriented Institute, 446 pages. Barcode 2020010005871   Scan available.

1862. Krtyakalapataru Of Bhatta Laksmidhara Vol.xiv.moksakanda  k.v. Rangaswami Aiyangar; Unknown, 1945, Oriented Institute, 436 pages. Barcode 2020010005872   Scan available.

1863. Krtyakalpataru Of Bhatta Lakshmidhara Vol Iv  Rangaswami Aiyangar; Unknown, 1950, Baroda Oriental Institute, 424 pages. Barcode 2020010005874   Scan available.

1864. Krtyakalpataru Of Bhatta Lakshmidhara Vol X  K V Ranga Swami Aiyangar; Unknown, 1950, Oriental_Institute, 290 pages. Barcode 2020010005875   Scan available.

1865. Krtyakalpataru Of Bhatta Laksmidhara Vol 3 Niyatakala Kanda  k v rangaswami aiyangar; Unknown, 1950, oriental insitute, 658 pages. Barcode 2020010005877   Scan available.

1866. Krtyaratnakara  C. Thakkura; Religion, 1925, The Asiatic Society Of Bengal Calcutta, 681 pages. Barcode 5010010001145   Scan not available.

1867. Kruushhnd-ayajuvaidiiyataittiriiyasan'hitaa_bhaaga_7  hari naaraayand-a aapat'e; RELIGION. THEOLOGY, 1904, Ananda Mudranalayamu , Madras, 580 pages. Barcode 5010010042467   Scan not available.

1868. Kruushhnd-ayajuvaidiyataittiriiyasan'hitaa Bhaaga 8  hari naaraayand-a aapat'e; RELIGION. THEOLOGY, 1905, Ananda Mudranalayamu , Madras, 868 pages. Barcode 5010010042373   Scan not available.

1869. Krxshhnd-a Bhakti Saahitya Vastu Srota Aura San'rachana  d'an' chandrabhaana raavata; Language. Linguistics. Literature, 0, shrii ven'kat'eshvaraa vishvavidyalaya, 315 pages. Barcode 5010010012473   Scan not available.

1870. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa  Krxshhnd-a Yajura~vedii; Religion. Theology, 1945, Bhaarata Mudrand-aalaye, 490 pages. Barcode 2030020016262   Scan not available.

1871. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa Panj-chamo Bhaaga  Shriimatsaayand-aachaara~yaa; Religion. Theology, 1946, Aanandaashramamudrand-alaye, 322 pages. Barcode 2030020016481   Scan not available.

1872. Krxshhnd-aayajuvediiyataittiriiyasan'hitaa Kanda Ii Part Iv  Kasinatha Sastri Agase; Language. Linguistics. Literature, 1901, Harinaraya Apte, 584 pages. Barcode 5010010027999   Scan not available.

1873. Krxshhnd-aayajuvediiyataittiriiyasan'hitaa Part Ii  Kasinatha Sastri Agase; Language. Linguistics. Literature, 1901, Harinaraya Apte, 390 pages. Barcode 5010010027976   Scan not available.

1874. Krxshhnd-ayajuravediiyaa Kapishht'ala Kat'ha San'hitaa  Raghu Vira; Language. Linguistics. Literature, 1932, Mehar Chand Lachhman Das, 354 pages. Barcode 5010010029780   Scan not available.

1875. Krxshhnd-ayajura~vediiya Taittiriiyaarand-yakama~ Prathamo Bhaaga  Shriimatsaayand-aachaarayaa; Religion. Theology, 1848, Aanandaashramamudrand-aalayan', 462 pages. Barcode 2030020016509   Scan not available.

1876. Krxshhnd-ayajura~vediiya Taittiriiyasan'hitaa Prathamo Bhaaga  Shriimatsaayand-aachaara~yaa; Religion. Theology, 1940, Aanandaashramamudrand-aalan', 413 pages. Barcode 2030020016504   Scan not available.

1877. Krxshhnd-ayajura~vediiya Taittiriiyopanishhata~ Pnj-chamiiyamang-kanaavrxtti  Vaamanashastrii Pand-d'ita; Religion. Theology, 1929, Aanandaashramamudrand-aalayan', 180 pages. Barcode 2030020016370   Scan not available.

1878. Krxshhnd-ayajura~vediiyataittiriiyasan'hitaa Da~viitiiyo Bhaaga  Shriimatsaayand-achaara~yaa; Religion. Theology, 1940, Aanandaashramamudrand-aalaye, 401 pages. Barcode 2030020016566   Scan not available.

1879. Krxshhnd-ayajura~vediiyataittiriyasan'hitaa Shhashht'ho Bhaagah  Shriimatsaayand-aachaara~yaa; Religion. Theology, 1948, Aanandaashramamudrand-aalaye, 545 pages. Barcode 2030020016564   Scan not available.

1880. Krxshhnd-ayajurvediiyataittiriiyasan'hitaa Bhaashhyasametaa Etatpustakamu  shriimatsaayand-aachaarya; Religion. Theology, 1901, aanandaashramamudrand-aalaya, 276 pages. Barcode 5010010024668   Scan not available.

1881. Krxshhnd-ayajuvaidiiya Taittiriiyasan'hitaa Ddhitiiyo Bhaaga  Sri Kasinath Sastri; Language. Linguistics. Literature, 1901, Hari Narayan Apte, Ananda Ashrama Publications, 478 pages. Barcode 5010010029074   Scan not available.

1882. Krxshhnd-ayajuvaidiiya Taittiriiyasan'hitaa Prathamo Bhaaga  Sri Kasinath Sastri; Language. Linguistics. Literature, 1900, Hari Narayana Apte, Ananda Ashrama Publications, 402 pages. Barcode 5010010029027   Scan not available.

1883. Krxshhnd-ayajuvaidiiya Taittiriiyasan'hitaa Trxtiiyo Bhaaga  Sri Kasinath Sastri; Language. Linguistics. Literature, 1901, Hari Narayan Apte, Ananda Ashrama Publications, 32 pages. Barcode 5010010029070   Scan not available.

1884. Krxshhnd-ollaasa Champuukaavyaprakaand-d'amu  shri paa raa subrahmand-yashaastriind-aa; Religion. Theology, 0, chennapuuryaa libart'ii mudrand-aalaya, 297 pages. Barcode 5010010024669   Scan not available.

1885. krxtyakalpataru brahmachaarikaand-d'an' Vol 1  Bhatta Lakshmidhara; SOCIAL SCIENCES, 1948, Oriental Institute, Baroda, 446 pages. Barcode 5010010030606   Server error, availability unknown.

1886. Krxtyakalpataru Daanakaand-d'an' Vol 5  Bhatta Lakshmidhara; Social Sciences, 1941, Oriental Institute, Baroda, 580 pages. Barcode 5010010030620   Scan not available.

1887. Krxtyakalpataru Grahasthakan'd'aa Vol 2  bhat't'a lakshmidhara; Religion. Theology, 1944, oriental institute, baroda, 659 pages. Barcode 5010010024670   Scan not available.

1888. Krxtyakalpataru Niyatakaalakaand-d'an' Vol 3  Bhatta Lakshmidhara; Social Sciences, 1950, Oriental Institute, Baroda, 646 pages. Barcode 5010010030627   Scan not available.

1889. Krxtyakalpataru Raajadhar^makaand-d'an' Vol 11  Bhatta Lakshmidhara; Social Sciences, 1943, Oriental Institute, Baroda, 406 pages. Barcode 5010010030690   Scan not available.

1890. Krxtyakalpataru Shraddhakaand-d'an' Vol 4  Bhatta Lakshmidhara; Social Sciences, 1950, Oriental Institute, Baroda, 420 pages. Barcode 5010010030692   Scan not available.

1891. krxtyakalpatarumoqs-akaand-d'an' Vol 14  Bhatta Lakshmidhara; SOCIAL SCIENCES, 1945, Oriental Institute, Baroda, 434 pages. Barcode 5010010030689   Server error, availability unknown.

1892. Krxtyasaagara  shriiratnapaand-i; Language. Linguistics. Literature, 1977, mithilaavidhyaapiit'ha, darbhaan'ga, 486 pages. Barcode 5010010028289   Scan not available.

1893. Krxyajuraveda  Not Available; Language. Linguistics. Literature, 1940, Narayan Vasudev Mahajani, 300 pages. Barcode 5010010029763   Scan not available.

1894. Ksemendra  ayendra sharma gen ed; Language. Linguistics. Literature, 1961, the sanskrit academy osmania university, 646 pages. Barcode 2020050036350   Scan not available.

1895. Ksemendra Ladrukhayasangra  Dr.ayendra Sharma; Unknown, 1961, Saskrit_Academy_Press, 644 pages. Barcode 2020010005881   Scan available.

1896. Ksemendra Studies  Dr Surya Kanta; Unknown, 1954, ORIENTAL BOOK AGENCY, 230 pages. Barcode 2020010005882   Scan available.

1897. Ksemendralahukavya Sangrha  ksemendra; Language. Linguistics. Literature, 1961, the sanskrit academy hyderabad, 646 pages. Barcode 2020050036082   Scan not available.

1898. kumaarasambhava  ta. gand-apatishaastrind-aa; Literature, 1913, Rajakeeya Press, 294 pages. Barcode 5010010091930   Scan not available.

1899. Kumaarasambhavan' Mahaakaavyamu Pun'savaniivyaakhyaaya Sanaathiikrxtamu  mahaakavishriikaalidaasa; Language. Linguistics. Literature, 1951, chaukhamba sanskrit series office, benares, 468 pages. Barcode 5010010024672   Scan not available.

1900. Kumarasambhava  kalidasa; Language. Linguistics. Literature, 1962, sahitya akademi new delhi, 308 pages. Barcode 2020050036081   Scan not available.

1901. Kumarasambhavam Mahakavyam  Dr.sudhakar Malaviya; Unknown, 1997, Krishnadas Academy, 592 pages. Barcode 2020010012164   Server error, availability unknown.

1902. Kumparnapuranam  Sri Neelamanimukhopadhya; Unknown, 1890, Girish_Vidhyarth_Yanthr, 777 pages. Barcode 2020010005902   Scan available.

1903. Kun'damaala  dinnaaga; Language. Linguistics. Literature, 1937, Motilal Banarasidass Publishers Private Limited, Delhi, 422 pages. Barcode 5010010028161   Scan not available.

1904. Kundamaalaa  Shriiding-a~naaga Mahaakavii; Language. Linguistics. Literature, 1929, Mumbaii San'skrxta Presa~, 258 pages. Barcode 2030020016403   Scan not available.

1905. Kundmala  krishna kumar davan; Language. Linguistics. Literature, 0, bhariya sanskrit bhavan jalandar, 358 pages. Barcode 2020050036351   Scan not available.

1906. Kurmapuranam  Dr.ramshankara Bhattacharya; Unknown, 1967, Indolajikal_Book_House, 234 pages. Barcode 2020010005906   Scan available.

1907. Kushhnd-agiiti  soomanaatha; Language. Linguistics. Literature, 1956, Rajasthan Oriental Research Institute , Jaipur ., 58 pages. Barcode 5010010012632   Scan not available.

1908. kushhnd-ayajuvaidiiyataitririiyasan'hitaa  hari naaraayand-a aapat'e; Religion, 1823, Anandashrama Press, 269 pages. Barcode 5010010087225   Scan not available.

1909. kushhnd-ayajuvaidiiyataitririiyasan'hitaa1  hari naaraayand-a aapat'e; Religion, 1822, Anandashrama Press, 565 pages. Barcode 5010010087246   Scan not available.

1910. kusumaajjali  vidyasaagara bhat'at'aachaarya; Literature, 1889, Kalakatta Printing Press , Kalakatta, 56 pages. Barcode 5010010092061   Scan available.

1911. Kusumaanj-ajalibodhanii  Sri Varadaraja Mishra; Philosophy. Psychology, 1922, Supernitendent, Govt Press, UP, 178 pages. Barcode 5010010029885   Scan not available.

1912. Kusumaanj-jali Shriimadudayanaachaar^yavitachita  Pandit Laxman Sastri Dravid; Philosophy. Psychology, 1912, Sri H.D. Gupta And Sons, 566 pages. Barcode 5010010029963   Scan not available.

1913. Kusumaanj-jalibodhani  varadaraaja; Language. Linguistics. Literature, 1922, government press, allahabad, 176 pages. Barcode 5010010025873   Scan not available.

1914. Kut't'aakaarishiromand-i  Shriidevaraaja; Natural Sciences, 1944, Da gavara~nament'a~ Brancha~ Presa~, 70 pages. Barcode 2030020016463   Scan not available.

1915. Kuttanirmatam Kavyam  Madhusudan Kaul; Unknown, 1944, Royal Asiatic Society, 124 pages. Barcode 2020010005915   Scan available.

1916. Kutuuhala Vrxtti  shrii vaasudeivadiiqs-ita; Language. Linguistics. Literature, 1908, Sri Vani Vilas Press , Srirangam., 268 pages. Barcode 5010010012389   Scan not available.

1917. Kutuuhalavrxtti  bhakta Darshan; Language. Linguistics. Literature, 1960, Sri Lalbahdurshastri Rashtriya Samskruta Vidya Pitam, 340 pages. Barcode 5010010025936   Scan not available.

1918. Kutuuhalavrxtti  bhakta Darshan; Language. Linguistics. Literature, 1960, Sri Lalbahdurshastri Rashtriya Samskruta Vidya Pitam, 526 pages. Barcode 5010010028290   Scan not available.

1919. Kutuuhalavrxtti Prathamodhyaaya  Diiqs-ita Vaasudeva; Religion. Theology, 1950, Shrii Vaand-ii Vilaasa, 456 pages. Barcode 2030020016195   Scan not available.

1920. Kutuuhalavrxttisaarasam'graha  Not Available; Philosophy. Psychology, 999, Not Available, 368 pages. Barcode 5010010029945   Scan not available.

1921. kuvalayaananda  raa. haalaasyanaathashaastrind-aa; Literature, 1802, Sri Vidya Press , Kumbhakonam, 298 pages. Barcode 5010010091998   Scan available.

1922. Kuvalayaananda  Shara~mand-aa Vaasudeva; Religion. Theology, 1917, Tukaaraama Jaavajii, 220 pages. Barcode 2030020016044   Scan not available.

1923. Kuvalayaananda Chanddraalokasahita Alang-kaarachandrikaavyaakhyaaya Cha Vibhuushhita  budhavarashriimadappayyadiiqs-ita; Language. Linguistics. Literature, 1833, shriiveng-kat'eshvara st'iimu mudrand-aayantraalaya, mun'bayya, 282 pages. Barcode 5010010024683   Scan not available.

1924. kuvalayaanandachandrikaachakairan'alad'akaaratatvaj'ja  Venkatachari; Art, 1943, Karoneshan Mudranalaya,Mysore, 319 pages. Barcode 5010010004354   Server error, availability unknown.

1925. Kuvalayaanandakaarikaa Alan'kaaradiipikaavyaakhyaayaa San'valitaa Trxtiiyaavrxtti  shriiyutaashaadharabhat't'a; Language. Linguistics. Literature, 1927, nirnayasagar press, bombay, 114 pages. Barcode 5010010025938   Scan not available.

1926. kyo uttaraadhai  Madavacharya Sastri; Religion, 1982, Madav Pustakalaya Dehali, 693 pages. Barcode 5010010001153   Server error, availability unknown.

Return to the top

L


1927. Laalaa Lajapatharaaya Yan'chen' Aatmacharitra Va Charitra  Kulakara~nii; Geography. Biography. History, 1931, Kara~naat'aka Presa~, 342 pages. Barcode 2030020016457   Scan not available.

1928. Laayanashrautasuutramu Vrxtti  naaraayand-a; Language. Linguistics. Literature, 1917, aanandaashramamudrand-aalaya, 471 pages. Barcode 5010010028291   Scan not available.

1929. Ladhu Ramayanam  Sri Govindnath Guha; Unknown, 999, Govindanath_Guha_Publications, 466 pages. Barcode 2020010005921   Scan available.

1930. Ladhunibandha  N C S Venkatacharya; Unknown, 1974, SASTRATNAMALA, 152 pages. Barcode 2020010005920   Scan available.

1931. Ladhupaaraasharii Madhyaparaasharii  kedaaradatta joshii; Religion. Theology, 999, motiilaala banaarasiidaasa, 128 pages. Barcode 2020050017214   Scan available.

1932. Laghu Kashika 1  Sudarshanacharya Tripathi; Linguistics Literature, 1983, Varanaseya_Sanskrit_University, 296 pages. Barcode 5010010001154   Scan not available.

1933. Laghu Parasari And Madhya Parasari  Pandit Sri Achyutananda Jha; Unknown, 999, Jayakrishnadas_Haridas_Gupta, 130 pages. Barcode 2020010005924   Scan available.

1934. Laghu Sabdendu Sekhara  Peri Venkateswara Sastri; Unknown, 1941, Sri_Vidhya_Press, 858 pages. Barcode 2020010005928   Scan available.

1935. Laghu Sabdendu Sekhara Vol I  Tata Subbaraya Sastri; Unknown, 1941, Vidhya_Press, 608 pages. Barcode 2020010005927   Scan available.

1936. Laghu Shabdendu Shekar  Pandith Nandkishore Shastri Ayurvedacharya; Unknown, 1936, Bhargava_Pustakalay, 1280 pages. Barcode 2020010005929   Scan available.

1937. Laghu Siddanta Kaumudi  Sri Varadharajacharya; Unknown, 1977, Kshemraj_Srikrishnadas, 496 pages. Barcode 2020010005930   Scan available.

1938. Laghu Siddhanta Kaumudi  Rajaraja Varma; Sanskrit Grammer, 1911, Trivendrum, 186 pages. Barcode 5010010007146   Scan not available.

1939. Laghu Siddhanta Kaumudii Pura~vaara~dharuupa Prathamo Bhaaga  Varadaraajaachaara~yaa; Language. Linguistics. Literature, 1954, Shaantii Presa aura Naviina Presa, 684 pages. Barcode 2030020016503   Scan not available.

1940. Laghu Upanishad  narayana swamy aiyar k tr; Religion. Theology, 1967, the akhila bharata sanskara seva samiti, 302 pages. Barcode 2020050036072   Scan not available.

1941. Laghubhaaskariiyama~  Shriibhaaskaraachaara~ya; Natural Sciences, 1946, Aanandaashramamudrand-aalayan', 133 pages. Barcode 2030020016465   Scan not available.

1942. laghuchan'drikaa  hariharashaastrii; Literature, 1893, Not available, 650 pages. Barcode 5010010092060   Scan not available.

1943. Laghukaumudii  varadaraaja; Language. Linguistics. Literature, 0, benaaras e je lajaarasa end-d'a koo, 415 pages. Barcode 5010010018010   Scan not available.

1944. laghukaumudovayaakarand-am  vidyaasaagara bhat'at'aachaaryend-a; Literature, 1877, Kalakatta Printing Press , Kalakatta, 210 pages. Barcode 5010010092124   Scan available.

1945. laghukomudii  0000; Linguistics Literature, 0, 0000, 147 pages. Barcode 5010010005207   Server error, availability unknown.

1946. Laghumaanasama~  Munj-jalaachaara~ya; Natural Sciences, 1952, Aanandaashramamudrand-aalayan', 46 pages. Barcode 2030020016468   Scan not available.

1947. laghumaanasamuu  Gangadhar Bapurao Kale; Philosophy. Psychology, 1944, Not Available, 40 pages. Barcode 5010010026469   Scan not available.

1948. laghupaaniiyamu  Rajaraja Varma; Sanskrit Grammer, 1911, Trivendrum, 228 pages. Barcode 5010010007145   Scan not available.

1949. Laghupaaraasharii  gagaavishhnd-a shriikruushhnd-adaasa; General, 2005, kalyaand-a, 44 pages. Barcode 2020050017185   Scan available.

1950. Laghupaaraasharii Bhaashhya  diivaana raamachandar kapuura; Religion. Theology, 999, motiilaala banaarasiidaasa, 396 pages. Barcode 2020050017210   Scan not available.

1951. Laghuparashari Madhyaparashari  shri achyuthananda jha; Unknown, 9999, choukhambha amarabharathi prakashan, 298 pages. Barcode 2020010005925   Scan available.

1952. laghuratnakoshha  purushhottamadeva; Literature, 1812, Not available, 131 pages. Barcode 5010010091938   Scan not available.

1953. Laghurkatantrasamgraha And Samasaptalaksana  Suryakanta; Unknown, 1940, Panini, 174 pages. Barcode 2020010005926   Scan available.

1954. Laghusabendusekjara  nagojibhatta; Language. Linguistics. Literature, 1927, jai krishnadas haridas gupta varnasi, 846 pages. Barcode 2020050036378   Scan not available.

1955. laghushabdandushakhara'  shriimannaageshabhat'aa; Religion, 1921, The Medical Hall Press, Benares, 571 pages. Barcode 5010010087235   Scan not available.

1956. Laghushabdedndushekhara Vyaakarand-avibhaage Saptadasan'pushhpamu Napadaantasuutraanto Bhaaga  mahaamahopaadhyaayashriinaageshabhat't'a; Language. Linguistics. Literature, 0, chaukhamba sanskrit series office, benares, 264 pages. Barcode 5010010025939   Scan not available.

1957. Laghushabdendukalaa  pand-d'ita shrii shobhaakaanta jhaa; Religion. Theology, 1970, chaukhambha sanskrit sansthan, vaaraand-asi, 144 pages. Barcode 5010010024686   Scan not available.

1958. Laghushabdendusekhara  khuhiijhaa; LANGUAGE. LINGUISTICS. LITERATURE, 1938, Jaya Krishna Das Hari Das Gupta , Benares, 264 pages. Barcode 5010010042483   Scan not available.

1959. Laghushabdendushekhara Napadaantasuutraanto Bhaaga  Shriinaageshabhat't'a Mahamahopaadhyaaya; Religion. Theology, 1938, Vidhyaa Vilaasa Presa~, 277 pages. Barcode 2030020016437   Scan not available.

1960. Laghushabdondushokhanamulapuvedhve  Unknown; Unknown, 999, Unknown, 163 pages. Barcode 5010010010783   Scan not available.

1961. Laghushabdondushokhanamulapuvedhve Dvitiyo Bhaagaha  Unknown; Unknown, 999, Unknown, 163 pages. Barcode 5010010010782   Scan not available.

1962. laghusiddaantakomudii  Kaushika Venkatanarasimhachari; Linguistics Literature, 1937, Ramaswamysastrulu amp Sons,Chennai, 186 pages. Barcode 5010010005208   Server error, availability unknown.

1963. Laghusiddanta Kaumudi  varda raja; Language. Linguistics. Literature, 1948, sayabhama bhai pandurang, 180 pages. Barcode 2020050036395   Scan not available.

1964. Laghusiddhaantakaumudii Anuvrxttyaadisuuchakena T'ippand-ena Pratyaahaara Varnd-avyavahaaragn-aapaka Koshht'akau  shriivaradaraajapand-d'ita; Language. Linguistics. Literature, 1894, Not available, 176 pages. Barcode 5010010025940   Scan not available.

1965. Laghusiddhaantakaumudii San'skrxta Hindiit'iikaa  shriivaradaraajaachaarya; Language. Linguistics. Literature, 1970, chaukhambhaa san'skrxta san'sthaana, vaaraand-asii, 382 pages. Barcode 5010010028182   Scan not available.

1966. Laghusiddhaantakaumuditattvaprakaasha Sottaraa Prashnaavali 20 Varshhaand-aan' Prashnapatrasahita  pand-d'itashriiraamagovindashukla; Language. Linguistics. Literature, 1974, motilaala banaarasiidasa, dilli, 248 pages. Barcode 5010010025941   Scan not available.

1967. laghusiddhana koumudi  pandita baradraja bhatta; Religion, 1896, Laxmi Venkateswar Press, Bombay, 586 pages. Barcode 5010010087198   Scan not available.

1968. Laghusiddhantkaumudi  Pandith Sri Narayana Dutt Shastrina; Unknown, 1993, GEETHA PRESS, 372 pages. Barcode 2020010005931   Scan available.

1969. Laghusidhantakoumudhi  Acharya Krishan Mohan Shastry; Unknown, 1998, KRISHNADAS ACADEMY, VARANASI, 310 pages. Barcode 2020010012181   Server error, availability unknown.

1970. Laghustuti  t'i gand-apati saastri; Language. Linguistics. Literature, 1917, Government Press, Trivendrum, 63 pages. Barcode 5010010024687   Scan not available.

1971. Lagusidhanthkoumudhi  Varadharajacharyapranith; Religion. Theology, 1993, Githapress, 290 pages. Barcode 2020050017239   Scan available.

1972. Lagusidhantkomudhi  Sri Girishkumar Tagore; Unknown, 1998, Krishna_Academy_Varanasi, 328 pages. Barcode 2020010012185   Server error, availability unknown.

1973. Lakshmi Sahasram Part 1  Raghunathaharya N c; Saktisrm, 2000, Divyavani Printers Warangal, 257 pages. Barcode 5010010007148   Scan not available.

1974. Lakshmi Tantra A Pancaratra Agama  Pandith V. Krishnamacharya; Unknown, 1959, The Adyar Library And Research Centre, 394 pages. Barcode 2020010005937   Scan available.

1975. Lakshmisahara  Venkatadhvari; Unknown, 1904, Printed_By_Hari_Das_Gupta, 314 pages. Barcode 2020010005935   Scan available.

1976. Lakshmisahasra Vol Iv  Dasharadhi; Unknown, 1867, Chowkhamba_Sanskrit_Series, 514 pages. Barcode 2020010005936   Scan available.

1977. lalitaatrishatiistotramuu  shriimachchhakara bhagavatpaade; Literature, 1911, Sri Vanivilas Press, 157 pages. Barcode 5010010092110   Scan available.

1978. Lalitamaadhavan' Naat'akamu T'ikayaa  shriiruupagoosvaamiprabhupaada; Language. Linguistics. Literature, 1969, chaukhambhaa san'skrxta pratishht'haana, dillii, 310 pages. Barcode 5010010025942   Scan not available.

1979. Lalitha Madhavam Gareth And Lynette  alfred lord tennyson; Unknown, 1988, panchakshari press, 162 pages. Barcode 2020010005940   Scan available.

1980. Lalleishvariivaakyaani  Not Available; Language. Linguistics. Literature, 0, Not Available, 36 pages. Barcode 5010010012630   Scan not available.

1981. Lalleshwari Vyakyani  -; Unknown, 999, -, 34 pages. Barcode 2020010005941   Scan available.

1982. laqs-and-aavimashe  V. Subrahmanya Sastri; Philosophy. Psychology, 0, Not Available, 32 pages. Barcode 5010010026468   Scan not available.

1983. Laqs-miisahasramu  Not available; Religion. Theology, 0, Not available, 813 pages. Barcode 5010010024691   Scan not available.

1984. Laqs-miitantramu  vi. krishhnd-amaachaarya; Language. Linguistics. Literature, 1959, The Adyar Library And Rersearch Center, Madras, 389 pages. Barcode 5010010024692   Scan not available.

1985. Laqs-miitantramuu Volume 87  pan'dita vi krxshhnd-amaachaarya; Language. Linguistics. Literature, 1959, Adyar Library And Research Centre , Chennai ., 391 pages. Barcode 5010010012629   Scan not available.

1986. Lat'akamelakamu  shriishadgadhara; Language. Linguistics. Literature, 1900, Tukaram Javaji,Bombay, 36 pages. Barcode 5010010032853   Scan not available.

1987. Latkamelakamu  Prakash; Unknown, 1962, CHOWKHAMBA VIDYABHAWAN, 65 pages. Barcode 2020010012206   Server error, availability unknown.

1988. Laugaaqs-i Grxhya Suutraand-i Bhaashhyopetaani Dvitiiyobhaaga Uttaraarthamu  devapaala; Language. Linguistics. Literature, 1937, nirnayasagar press, bombay, 460 pages. Barcode 5010010024693   Scan not available.

1989. Laugaaqs-i Grxhya Suutraand-i Devapaalakrxtabhaashhyopetaani Vol 2  Madhusudan Kaul Shastri; Language. Linguistics. Literature, 1934, Maharaja Of Kashmir, 448 pages. Barcode 5010010029063   Scan not available.

1990. Laukikanyaayaanj-jali Dvitiiyobhaaga  colonel g a jacob; Language. Linguistics. Literature, 1925, nirnaya sagar press, bombay, 94 pages. Barcode 5010010025945   Scan not available.

1991. Laukikanyaayaanj-jali Trxtiiyobhaaga  colonel g a jacob; Language. Linguistics. Literature, 1911, nirnayasagar press, bombay, 158 pages. Barcode 5010010025946   Scan not available.

1992. Lavangee  Prakash; Unknown, 1999, -, 34 pages. Barcode 2020010012207   Server error, availability unknown.

1993. Le Role Des Forets Dans Le Developpement Des Collectivites Locales Forets7  J P George; Language. Linguistics. Literature, 1978, Organisation Des Nations Unies Pour L Alimentation Et L Agriculture, 134 pages. Barcode 2020050017284   Scan not available.

1994. Lectures On Patanjali S Mahabhasya Vol 2 Ahnikas 4 6  P S Subramanya Sastri; Unknown, 1951, Annamalainagar, 314 pages. Barcode 2020010005954   Scan available.

1995. Lectures On Patanjali s Mahabhasya Vol I  subrmanya sastry p s; Language. Linguistics. Literature, 1944, anamalai university, 384 pages. Barcode 2020050036383   Scan not available.

1996. Lectures On Patanjalis Mahabhasya Vol I I I  P S Subrahmanya Sastri; Unknown, 1955, Trichinopoly_United_Printers_Limited, 326 pages. Barcode 2020010005957   Scan available.

1997. Leelavathi  Vinayak Ganesh Aapte; Unknown, 999, Ananda_Shram_Mudranalay, 146 pages. Barcode 2020010005959   Scan available.

1998. Leelavathi Uttarshorupo Dwithiyo Bhagah  vinayak ganesh apte; Unknown, 1812, anandhashramasamskruthagrandhavali, 178 pages. Barcode 2020010005958   Scan available.

1999. Life Divine  aurobindo; Language. Linguistics. Literature, 1942, aurobindo press, 160 pages. Barcode 2020050058026   Scan not available.

2000. Life Of Pingali Suuranaarya  Tekumalla Achyuta Rao; Language. Linguistics. Literature, 0, V. M. R. Press, Pithapuram, 374 pages. Barcode 5010010025948   Scan not available.

2001. Liilaavatii  pt.shri lakhanlal jha; General, 2005, chowkhamba vidyabhawan, 386 pages. Barcode 2020050017193   Scan available.

2002. liilaavatii  ; Religion, 1855, Calcutta School Book Society Press, Calcutta, 200 pages. Barcode 5010010087183   Scan not available.

2003. liilaavatii  shriibhaaskaraachaarya; Literature, 1885, Kalakatta Printing Press , Kalakatta, 99 pages. Barcode 5010010092094   Scan available.

2004. Liilaavatii Pura~vara~dharupam Prathamo Bhaaga  Shriimadbhaskaraachaaryaa; Natural Sciences, 1937, Aanandaashramamudrand-aalayan', 150 pages. Barcode 2030020016461   Scan not available.

2005. Liilaavatii Uttaraardharuupo Dvitiiyobhaaga  shriimadbhaaskaraachaarya; Language. Linguistics. Literature, 1937, aanandaashramamudrand-aalaya, 180 pages. Barcode 5010010025949   Scan not available.

2006. Liilaavatii Uttarara~dharupo Da~vitiiyo Bhaaga  Shriimadbhaskaraachaara~yaa; Natural Sciences, 1937, Aanandaashramamudrand-aalayan', 187 pages. Barcode 2030020016397   Scan not available.

2007. Ling-ganushaasanamam  Panini; Philosophy. Psychology, 1885, University Of Culcutta, 192 pages. Barcode 5010010029748   Scan not available.

2008. Ling-kapuraand-amuu  mahaarshhi vedavyaasa; Religion. Theology, 1885, Not available, 848 pages. Barcode 5010010017740   Scan not available.

2009. Linganusasana  Harsavardhana; Unknown, 1931, University_Of_Madras, 194 pages. Barcode 2020010005968   Scan available.

2010. Linganusasana Of Durgasimha  Dattatrey Gangadhar Koparkar; Unknown, 1952, Poona, 120 pages. Barcode 2020010005967   Scan available.

2011. List'as Aaph Manuscript's  Not Available; General, 1925, Bhandarkar Oriental Research Institution, Poona, 106 pages. Barcode 5010010024696   Scan not available.

2012. Literary Circle Of Mahamatya Vastupala And Its Contribution To Sanskrit Literatute  bhogilal; Unknown, 1953, bharatiya vidhya bhavan, 268 pages. Barcode 2020010005971   Scan available.

2013. Literary History Of Sanskrit Buddhism  Nariman G K; History, 1923, Indian Book Depot, 424 pages. Barcode 150253   Server error, availability unknown.

2014. Lokaparalokakaasudhaara Bhaaga 2  hanumaana prasaada; LANGUAGE. LINGUISTICS. LITERATURE, 0, Geeta Press , Gorakpur, 244 pages. Barcode 5010010042531   Scan not available.

2015. Lokaparalokakaasudhaara Bhaaga 4  hanumaana prasaada; LANGUAGE. LINGUISTICS. LITERATURE, 0, Geeta Press , Gorakpur, 288 pages. Barcode 5010010042540   Scan not available.

2016. Lokaprakasha Of Kshemendra  Pandit Jagaddhar Zadoo Shastri; Unknown, 1947, THE PIONEER PRESS, 104 pages. Barcode 2020010005976   Scan available.

2017. Lokikanyaayaatralin' Tutiyo Bhaagan  jaakobha; Language. Linguistics. Literature, 1904, Tukaram Javaji,Bombay, 169 pages. Barcode 5010010032859   Scan not available.

Return to the top

M


2018. Ma. Gaan'dhii Dara~shana~  Aapat'e; Geography. Biography. History, 1948, Lokasan'graha ChhaapaKhaanaa, 277 pages. Barcode 2030020016489   Scan not available.

2019. Maadava Vijaya  Not Available; Language. Linguistics. Literature, 0, Not Available, 457 pages. Barcode 5010010012628   Scan not available.

2020. Maadhamaahaatmaya  Unknown; Religion. Theology, 999, Unknown, 134 pages. Barcode 5010010010778   Scan not available.

2021. Maadhavanala Kaamakn'dalaa  shriikrxshhnd-adaasaatmaja; Language. Linguistics. Literature, 1889, shriiven'kat'eshvara chhaapaakhaane, 214 pages. Barcode 5010010012561   Scan not available.

2022. Maadhaviiyaa Dhaatuvrxtti Paand-iniiyadhaatupaat'havyaakhyaanaatmikaa  shriisaayand-aachaarya; Language. Linguistics. Literature, 1964, praachyabhaaratiiprakaashanamu vaarand-asii, 720 pages. Barcode 5010010025951   Scan not available.

2023. Maadhaviyaadhatuvarittii  Chaara~yaa Vyaakarand-a; Language. Linguistics. Literature, 1934, Jai Krxshhnd-adaasa Haridaasa Gupta, 491 pages. Barcode 2030020016131   Scan not available.

2024. Maadhurii Darshanamu  raayaproolu subbaaraavu; Language. Linguistics. Literature, 0, Sahiti Samiti, Guntur, 69 pages. Barcode 5010010028278   Scan not available.

2025. maadhvamukhabhad'ga  Sri Surya Narayana Shyam Sukhla; Philosophy. Psychology, 0, Beconoor Maharaja Swami Shivanandapuri, 48 pages. Barcode 5010010026467   Scan not available.

2026. Maajhaa Sn'giita Vyaasan'ga  T'en'be Govin'da; Geography. Biography. History, 1951, Kilauskara Pres, 270 pages. Barcode 2030020016305   Scan not available.

2027. Maajhii Vilaayatachii Saphara~  Korat'akara Vit't'alakeshavaraava; Geography. Biography. History, 1946, Deshamukha Aand-i kan'pani, 86 pages. Barcode 2030020016416   Scan not available.

2028. Maal'avikaan'gnimitramu Naamanaat'akamu  shriimatkavikulashiromand-inaa shriikaal'idaasamahaakavi; Language. Linguistics. Literature, 1892, Not available, 282 pages. Barcode 5010010028272   Scan not available.

2029. Maalati Maadhava Sekand'a~ Ed'iishana~  Bhavabhuuti; Philosophy. Psychology, 1928, Gopaala~ NAaraayand-a~ Kan'panii, 501 pages. Barcode 2030020016435   Scan not available.

2030. maalatiimaadhava prakarand-am  Not available; Literature, 1836, Not available, 581 pages. Barcode 5010010091992   Scan not available.

2031. Maalatiimaadhavama~  Devadhara; Language. Linguistics. Literature, 1935, Not, 491 pages. Barcode 2030020016309   Scan not available.

2032. Maalatiimaadhavamuu  raamakuushhnd-a teilad'ga; LANGUAGE. LINGUISTICS. LITERATURE, 1822, nind-iyasaagarayatraalayaadhipatinaa svakiiyei mudraayatre mudrayitvaa praakaashyan' niitamuu, mumbayayaan', 408 pages. Barcode 5010010078840   Scan available.

2033. Maalatiimaadhavan' Naamaprakarand-ama~  Shriibhavabhuutii Mahaakavii; Religion. Theology, 1913, Da Orient'ala~ Pablishinga~ Kan'panii, 474 pages. Barcode 2030020016453   Scan not available.

2034. Maalatiimaadhavan' Prakarand-amu Vyaakhyaaya  mahaakavishriibhavabhuuti; Language. Linguistics. Literature, 1864, shriijiivaanandavidhyaasaagarabhat't'aachaarya, 500 pages. Barcode 5010010025952   Scan not available.

2035. Maalatiimaadhavan' Prakarand-amu Vyaakhyaaya  mahaakavishriibhavabhuuti; Language. Linguistics. Literature, 1864, shriijiivaanandavidhyaasaagarabhat't'aachaarya, 310 pages. Barcode 5010010028275   Scan not available.

2036. maalavikaagnimitram  Not available; Literature, 1912, Not available, 182 pages. Barcode 5010010092050   Scan available.

2037. Maan'nd-d'ukyopanishhada~ Taittiriiyapanishhada~ Aavrxtti Pahilii  Bid'e Sadhaashivashaastrii; Philosophy. Psychology, 1930, Gajaanana Vishvanaatha Ketakara, 266 pages. Barcode 2030020016419   Scan not available.

2038. Maanameyaarahasyashlokavara~tikama~ Sakalashaastrasaarasan'graharupama~  Shriinivaasaachara~yaa Laqs-miipurama~; Language. Linguistics. Literature, 1925, Raajakiiya Shaakhaa Mudraayantraalaye, 685 pages. Barcode 2030020016534   Scan not available.

2039. maanameyarahasyalokavaatvikamu  Srinivasa Charya. L; Sanskit Sastras, 1925, , 672 pages. Barcode 5010010007187   Scan not available.

2040. Maanameyarahasyashlokavara~tikama~  Shriinivasaachaara~ya Laqs-miipurama~; Language. Linguistics. Literature, 1924, Raajakiiya Shaakhaa Mudrand-aalayan', 677 pages. Barcode 2030020015985   Scan not available.

2041. maanameyoday  naaraayand-a bhat't'a; Literature, 1912, Rajakeeya Press, 134 pages. Barcode 5010010092055   Scan available.

2042. Maanameyoodaya  t'i. ganapati saastri; Language. Linguistics. Literature, 1912, Trivendraum Government Press,Trivendrum, 133 pages. Barcode 5010010024704   Scan not available.

2043. Maanasagarii  Dr . ramachandra pandey; General, 2005, krishnadas academy, 540 pages. Barcode 2020050017221   Scan available.

2044. Maanasaprachaarikaa  Not available; Language. Linguistics. Literature, 1885, mun'shii navalakishoor chhaapekhaanei, 156 pages. Barcode 5010010012627   Scan not available.

2045. Maanava Dharma Saara  Not Available; LANGUAGE. LINGUISTICS. LITERATURE, 1943, Kasi Vidyapitha , Benares, 285 pages. Barcode 5010010042527   Scan not available.

2046. Maanavaa Grxhayasuutraa  Shaastrii Raamaakrxshhnd-a Hara~shaajii; Religion. Theology, 1926, Sen't'arla Laibrarii, 327 pages. Barcode 2030020016081   Scan not available.

2047. Maanavii San'skrxtiicha Itiihaasa  Kara~ve Chintaamand-agand-esha; Geography. Biography. History, 1931, Mahaarashhat'ra Vividha jnj-aanamaalaa, 115 pages. Barcode 2030020016371   Scan not available.

2048. Maand-d'uukyaadhupanishhatrayii  pn'. raamadevaachaaye; RELIGION. THEOLOGY, 0, Not Available, 474 pages. Barcode 5010010042502   Scan not available.

2049. Maara~ka T'a~vena  Kulakara~nd--ii Ran'ganaatha; Geography. Biography. History, 1944, Ga Paan' Parachure Prakaashana Mandira, 182 pages. Barcode 2030020016391   Scan not available.

2050. maargoopadeshikaa  shriidhara ramakrisna bhandarkara; Religion, 1885, Ganpat Krishnaji Press, Bombay, 185 pages. Barcode 5010010087200   Scan not available.

2051. maargoopadeshikaa1  ramakrisna gopala bhandarkara; Religion, 1920, C.S. Deolo Press, Bombay, 246 pages. Barcode 5010010087187   Scan not available.

2052. maatukaabhedatantramu  Pandit Amareswar Thakur; Lord Hanuman, 1933, Metro Politan Printing amp Publishing House Limited . Calcutta, 153 pages. Barcode 5010010007204   Scan not available.

2053. maayaavaadakhan'd'anamu  Srimadananda Theertha; Art, 1875, Lakshmi Venkateswara Steam Press Mumbai, 165 pages. Barcode 5010010004351   Server error, availability unknown.

2054. Madanamaharnava  sri visvesvara bhatta; Unknown, 1953, oriental insitute, 448 pages. Barcode 2020010006005   Scan available.

2055. Madanapaamnidhant  krishna das; Technology, 1954, -, 192 pages. Barcode 2020050036241   Scan not available.

2056. Madanapaamnidhant  krishna das; Technology, 1954, -, 328 pages. Barcode 2020050036366   Scan not available.

2057. Madanpalnidhantu  Pandith Ravi Dutt; Unknown, 1867, SRI LAXMI VENKATEHWAR MUDRANALAY, 314 pages. Barcode 2020010006007   Scan available.

2058. maddhvamukhaalankaara  Vanamali Misra; Philosophy. Psychology, 1936, The Princess Of Wales Saraswathi Bhavana Texts, 148 pages. Barcode 5010010026466   Scan not available.

2059. Madhavanidan  Vijayarakshita And Shri kanthadatta; Unknown, 1932, Bhargava Pustakalaya, 792 pages. Barcode 2020010006012   Scan available.

2060. Madhavanidana  madhakara; Unknown, 1986, chaukhambha orientalia, 456 pages. Barcode 2020010006011   Scan available.

2061. Madhavanidhan  sri madhuvakar; Unknown, 999, tajkumar press book depot, 590 pages. Barcode 2020010006013   Scan available.

2062. Madhavnindanam  Sri Vrajwallabh Sharmana; Unknown, 999, Sri_Venkateshwar_Steem_Press, 741 pages. Barcode 2020010006015   Scan available.

2063. Madhthasida Ntakaumudii  prabhaakara; LANGUAGE. LINGUISTICS. LITERATURE, 1939, Moti Lal Banarsi Dass , Bombay, 693 pages. Barcode 5010010042528   Scan not available.

2064. Madhura Vijaya Or Virakamparaya Charita  Ganga Devi; Geography. Biography. History, 1924, The Sridhara Power Press, Trivandrum, 84 pages. Barcode 5010010009642   Scan not available.

2065. Madhura Vijayam  Gaddangadevi; Unknown, 1969, K L N SANSKRIT KALASHALADHYAPAK, 710 pages. Barcode 2020010006025   Scan available.

2066. madhuraan'jali  G.ramacharya; Literature, 1996, P.R.Galagau Hubli, 346 pages. Barcode 5010010001192   Server error, availability unknown.

2067. madhusuudanasarasvati kruti advatasiddhi  Sri Harihara Sastri; Philosophy. Psychology, 1893, V. Sambhashiva, 344 pages. Barcode 5010010026465   Scan not available.

2068. Madhuvidhyaa Shriivishvakarmapaaramyaparend-a Sauparnd-ena Vyaakhyaanena Samaalin'gitaa  durishet'i ven'kat'araamaachaarya; Language. Linguistics. Literature, 0, gn-aanabhaand-d'aara karnd-at'aa, 70 pages. Barcode 5010010025957   Scan not available.

2069. Madhvanidanmu  shrii sudarshan sharma; Technology, 0, chowkhamba sanskrit series office varanasi, 530 pages. Barcode 2020050036050   Scan not available.

2070. Madhvasiddaan'tasaarasan'grahada Vishhanurxmand-ii  Not available; Language. Linguistics. Literature, 0, Not available, 253 pages. Barcode 5010010017954   Scan not available.

2071. Madhvatantramukhamadarnamu  shriimadappayadiiqs-ita; Language. Linguistics. Literature, 1940, aanandaashramamudrand-aalaya, 156 pages. Barcode 5010010024712   Scan not available.

2072. Madhvatantramukhamara~danama~  Shriimadappayyadiiqs-ita; Philosophy. Psychology, 1930, Aanandaashramamudrand-aalayan', 162 pages. Barcode 2030020016357   Scan not available.

2073. Madhyakaaliina San'skrxta Naat'aka  raamjii upaadhyaaya; Language. Linguistics. Literature, 1974, Vidhyavilas Press, Varanasi, 516 pages. Barcode 5010010028270   Scan not available.

2074. Madhyakalin Hindi Sant Vichar Aur Sadhana  Keshani Prasad Chaurashiya; Literature, 1965, Hindustani Academy, Allahabad, 589 pages. Barcode 5990010044052   Server error, availability unknown.

2075. Madhyakaumudini Rahasyam Prashnottari  Pandith Sri Ramchandra Bhatt; Unknown, 1953, CHOWKHAMBA SANSKRIT SERIES OFFICE, 198 pages. Barcode 2020010006029   Scan available.

2076. Madhyama Kavatara Par Candrakirti  Valle poussin; Unknown, 1992, Motilal Banarasidass Publishers, 444 pages. Barcode 2020010006030   Scan available.

2077. Madhyamavyaayoga  gand-apati; LANGUAGE. LINGUISTICS. LITERATURE, 1917, Sridhara Printing House , Trivandrum, 64 pages. Barcode 5010010078269   Scan available.

2078. madhyamavyaayoga  ta. gand-apatishaastrii; Literature, 1812, Rajakeeya Press, 130 pages. Barcode 5010010092075   Scan available.

2079. Madhyamavyayoga  bhasa; Language. Linguistics. Literature, 1948, university manuscripts library trivandauram, 56 pages. Barcode 2020050036361   Scan not available.

2080. Madhyanta Vibhanga  Vasubhandu And Sthiramati; Unknown, 1992, Motilal Banarsidass Publishers, 180 pages. Barcode 2020010006031   Scan available.

2081. madhyasiddhaan'ntakaumudii  tukaaraama jaavajii; Literature, 1910, Nirnayasagar Press , Mumbai, 274 pages. Barcode 5010010092018   Scan available.

2082. Madhyasiddhaantakaumudii  shriimadvaradaraaja; Religion. Theology, 1906, paarvatiivaradaa mudrand-aalaya, 312 pages. Barcode 5010010024713   Scan not available.

2083. Madvanidhan  P.chaudika prasad sharma; Unknown, 1951, Ram Kumar Bookdeport, 596 pages. Barcode 2020010006038   Scan available.

2084. Madvanidhanamu  khemraj Shri krishnadas; Unknown, 1983, -, 406 pages. Barcode 2020010006037   Scan available.

2085. Madyakalin Sanskrit Natak  ramji upadya; Language. Linguistics. Literature, 0, sanskrit parishad sagar university, 522 pages. Barcode 2020050036087   Scan not available.

2086. Maenkavishwamithram  Dr Hari Narayan Dixit; Unknown, 1984, EASTERN BOOK LINKERS, 104 pages. Barcode 2020010006039   Scan available.

2087. Maghas Sisupalavadham Canto I I Edition V I  Saradaranjan Ray Vidyavinodha; Unknown, 1917, KUMUDRANJAN RAY, 170 pages. Barcode 2020010006043   Scan available.

2088. Maha Bandho Vol Iii Book Iv  Phool Chand Siddhanth Shastry; Unknown, 1956, Bharateey_Gyan_Peeth_Kashi, 454 pages. Barcode 2020010006046   Scan available.

2089. Maha Bhashyam  -; Unknown, 999, -, 408 pages. Barcode 2020010006061   Scan available.

2090. mahaaban'dho  Sripati Sharada Misra; Literature, 2001, Bharateeya Janapita Kasi Kasi, 493 pages. Barcode 5010010007171   Scan not available.

2091. Mahaaban'dho Bhaaga 2  Bhagavan'ta Bhad'aaraya Bhuudabali; Religion. Theology, 1953, Devataa Prasaada Gahamarii san'saara Presa, 503 pages. Barcode 2030020016232   Scan not available.

2092. Mahaaban'dho Pustaka~ 3  Bhuda~bali Bhagavan'ta~; Religion. Theology, 1954, Bharatiya Jnapiit'ha Kaashii, 520 pages. Barcode 2030020016283   Scan not available.

2093. Mahaabhaarata 13 Anushaakanapara~va  Saatalekara Daamodara; Language. Linguistics. Literature, 1931, Daamodara Saatalekara, 1086 pages. Barcode 2030020016039   Scan not available.

2094. Mahaabhaarata Aranyakaparvam Bhaaga 4  vishnu s sukthankar; Language. Linguistics. Literature, 1942, bhandarkar oriental research institute poons, 610 pages. Barcode 5010010017741   Scan not available.

2095. Mahaabhaarata Sabhaaparvamu Gn-aanadiipikaa  shriidevabodha; Religion. Theology, 1949, bhandaarkar oriental research institute poona, 55 pages. Barcode 5010010017742   Scan not available.

2096. Mahaabhaarata San'skrxta Muula Hindii Anuvaada  Not available; Religion. Theology, 0, Not available, 1282 pages. Barcode 5010010025642   Scan not available.

2097. mahaabhaaratam sabhaaparva  Not available; Literature, 1896, Not available, 188 pages. Barcode 5010010092077   Scan available.

2098. mahaabhaaratama~ aadipar^va  Maharshi Vedavyasar; LANGUAGE. LINGUISTICS. LITERATURE, 1809, P. C. Roy, 784 pages. Barcode 5010010032473   Server error, availability unknown.

2099. mahaabhaaratama~ anushaasanapar^vand-i Part I  P. P. Subramaniya Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1935, V. Ramaswami Sastrulu And Sons, 732 pages. Barcode 5010010032476   Server error, availability unknown.

2100. Mahaabhaaratama~ Prathama Bhaaga Viraat'apara~vama~  Raghuviiraa; Language. Linguistics. Literature, 1936, Band'aara~kara~ Orient'ala Riisera~cha Ist'iit'a~yut'a~, 448 pages. Barcode 2030020016533   Scan not available.

2101. Mahaabhaaratama~ Sat'iikama~ Chatura~to Bhaaga Drond-apara~va  Shriimanniilakand-t'ha; Language. Linguistics. Literature, 1931, Chitrashaala Presa~, 832 pages. Barcode 2030020015978   Scan not available.

2102. Mahaabhaaratama~ Shaantipar^vand-i Part I  P. P. Subramanya Sastri; Language. Linguistics. Literature, 1935, V. Ramaswamy Sastrulu And Sons, 690 pages. Barcode 5010010032335   Scan not available.

2103. mahaabhaaratama~ shaantipar^vand-i Part III  P. P. Subramaniya Sastri; LANGUAGE. LINGUISTICS. LITERATURE, 1936, V. Ramaswami Sastrulu And Sons, 726 pages. Barcode 5010010032399   Server error, availability unknown.

2104. Mahaabhaaratapraveshikaa  Kaand-e Pii Vii; Social Sciences, 1912, Ganapata~ Krxshhnd-aji presa~, 172 pages. Barcode 2030020016426   Scan not available.

2105. Mahaabhaashhyakunj-chikaa Darabhang-gaamand-d'alaantargara T'haad'hii Graamanivaasinaa  pand-d'itashriiharishang-karatbhaasharmand-aa; Language. Linguistics. Literature, 1970, motilaala banaarasiidasa, dilli, 112 pages. Barcode 5010010028279   Scan not available.

2106. Mahaabhaashhyama~ Prathama Grantha  Manmukundamuni; Language. Linguistics. Literature, 1835, Aatmaaraama, 70 pages. Barcode 2030020016113   Scan not available.

2107. Mahaabhaashhyamuu  Not available; Language. Linguistics. Literature, 0, Not available, 575 pages. Barcode 5010010018002   Scan not available.

2108. Mahaabhaashhyat'iikaa Chaturthaanhikaparyantaa Bhaaga 1  shrii vii svaaminaathana; Language. Linguistics. Literature, 1965, nepaala raajya san'skrxta prakaashana mand-d'ala, vaaraand-asii, 190 pages. Barcode 5010010025643   Scan not available.

2109. Mahaakaavyaa Ratnaavalii  Unknown; Unknown, 999, Unknown, 202 pages. Barcode 5010010010776   Scan not available.

2110. Mahaakavibhaasa Eka Adhyayana  baladeva upaadhyaaya; Language. Linguistics. Literature, 1982, Chowkamba Sanskrit Book Depot, Benaras, 190 pages. Barcode 5010010028282   Scan not available.

2111. Mahaanaarayand-a Upanishhada  Mahaanaarayand-a; Philosophy. Psychology, 1888, Nira~naya Saagara~ Presa~, 92 pages. Barcode 2030020016348   Scan not available.

2112. Mahaapuraand-ama~ Uttarapurand-aada~vitiiyaara~dhabhuutah Trxtiiya Khand-d'a  Vipushhpadantaa Mahaakavi; The Arts, 1941, Nyuu Bhaarata Print'in'ga~ Presa~, 385 pages. Barcode 2030020016439   Scan not available.

2113. Mahaapuraand-apanachamapathalakaand'aa  Somraj Krishna Das; Unknown, 999, Sri Venkateshwara Steam Press, Mumbai, 1066 pages. Barcode 5010010010775   Scan not available.

2114. Mahaapurand-ama~ Da~tiiya Khand-d'a  Pushhpadantaa Mahaakavii; Language. Linguistics. Literature, 1940, Maand-ikachandradigambarajainagranthamaalaasamiti, 601 pages. Barcode 2030020016536   Scan not available.

2115. Mahaaraaja Shivaajii  Pand'e Siitaaraama Vasudeva; Geography. Biography. History, 1919, Ema Sii Kot'aarii, 176 pages. Barcode 2030020016408   Scan not available.

2116. Mahaaraashht'a San'ta Kavayitri  Aajagaan'vakara Jagannatha Raghunaatha; Geography. Biography. History, 1931, Man'gesh Naaraayand-a Kulakara~nii, 232 pages. Barcode 2030020016414   Scan not available.

2117. Mahaaradha Padakooshaa  Not available; Language. Linguistics. Literature, 0, Not available, 795 pages. Barcode 5010010017772   Scan not available.

2118. Mahaarashhatra Itihaasaman'jarii  Aapat'e Dattaatrayavishhnd-u; Geography. Biography. History, 1845, Chitrashaalaa Presa~, 378 pages. Barcode 2030020016358   Scan not available.

2119. Mahaatmaajiin'che Satyaache Prayoga Athavaa Aatmakathaa  Gaan'dhiijii Mohana~daasa~karama~chanda~; Geography. Biography. History, 1951, Sulabha~ mudrand-aalayan', 503 pages. Barcode 2030020016516   Scan not available.

2120. Mahaavidhyaavid'ambanamu T'ikaabhyaan' Dashashlokii Vivarand-a T'ippand-i  bhat't'avaadiindra; Language. Linguistics. Literature, 1920, central library baroda, 248 pages. Barcode 5010010025644   Scan not available.

2121. mahaaviiracharitam  Not available; Literature, 1885, Not available, 132 pages. Barcode 5010010092083   Scan available.

2122. Mahaaviiracharitamu  shriibhavabhuti; Language. Linguistics. Literature, 1901, Tukaram Javaji,Bombay, 301 pages. Barcode 5010010032911   Scan not available.

2123. Mahaban'dho Prathama Bhaaga  Bhuutabalibattaraka Bhagavan'ta~; Religion. Theology, 1947, Bhaaratiiya Jnaanapiit'ha Prakashana, 537 pages. Barcode 2030020016286   Scan not available.

2124. Mahabharat Sahitha Pradma Kand  vyasa; Language. Linguistics. Literature, 1971, bhandarakar oriental research institute poona, 894 pages. Barcode 2020050036054   Scan not available.

2125. Mahabharata Tatparya Nirnaya With Comm Anandha Thirtha  Unknown; Unknown, 0, Unknown, 765 pages. Barcode 5010010010777   Scan not available.

2126. Mahabharatha Kosha  ramkumar rai; Unknown, 1982, chowkamba sanskrit series office, 750 pages. Barcode 2020010006052   Scan available.

2127. Mahabharathamu  -; Unknown, 999, -, 790 pages. Barcode 2020010006053   Scan available.

2128. Mahabharathtatvadeep  Mahabharathmarmagya Varnasi Subhramya Shastry; Unknown, 0, Granth_Adhikari_Swaythikrutha, 315 pages. Barcode 2020010006056   Scan not available.

2129. Mahabharathvachanamruthm  Sri Charudevshastryna; Unknown, 1986, Parimal Publications, 166 pages. Barcode 2020010006057   Scan available.

2130. Mahabhashyam  -; Unknown, 999, -, 556 pages. Barcode 2020010006060   Scan available.

2131. Mahabhasya Praskash  P. Madhukanth; Unknown, 1986, Chowkhamba_sanskrit_Seroies_Office, 77 pages. Barcode 2020010012316   Server error, availability unknown.

2132. Mahabhasyam  -; Unknown, 999, -, 744 pages. Barcode 2020010006062   Scan available.

2133. Mahakavi Bhasas Swapna Vasavdatta Natak  Pandit Guru Prasad Shastri; Unknown, 1951, BHARGAVA PUSTAKALAY, 370 pages. Barcode 2020010006064   Scan available.

2134. Mahanirvana Tantra Vol Xiii With The Commentary Of Hariharananda Bharati  -; Unknown, 1929, Motilal banarasidass, 502 pages. Barcode 2020010006072   Scan available.

2135. Mahapurana Vol Ii Uttar Purana  Pannalal Jain; Unknown, 1954, Bharayatia_Jananapitha_Kashi, 670 pages. Barcode 2020010006078   Scan available.

2136. Maharaja Bhojarajas Sringar Prakasha  G R Josyer; Unknown, 1955, G S JOSYER THE CORONATION PRESS, 354 pages. Barcode 2020010006083   Scan available.

2137. Maharajas Sanskrit College Magzine  Shri Yogendra; Vayu Purana, 1918, Yoga Institute Bombay, 334 pages. Barcode 5010010001773   Scan not available.

2138. Maharastriya Gyan Kosh Sharir Khand  sridhar venkatesh kethkar; General, 1928, maharastriya gyankosh mandal nagpur, 442 pages. Barcode 2020050058022   Scan not available.

2139. Mahartha Majari  M.r. Shastri; Unknown, 1918, Tatva Vivechaka Press Bombay, 153 pages. Barcode 5010010002044   Scan not available.

2140. Mahaveera Charithramu  Unknown; Religion. Theology, 1929, Unknown, 709 pages. Barcode 5010010010774   Scan not available.

2141. Mahaviirachacharitaa  Bhaavabhuuti; The Arts, 1926, Nira~naya Saagara~ Presa~, 285 pages. Barcode 2030020016311   Scan not available.

2142. Mahavira Charita Of Mahakavi Sri Bhavabhuti  Acharya Sri Ramachandra Mishra; Unknown, 1968, Chowkhamba Vidyabhavan, 360 pages. Barcode 2020010012354   Server error, availability unknown.

2143. Mahaviracharita Of Bhavabhuti  Anundoram Borooah; Unknown, 1969, PUBLICATION BOARD, 284 pages. Barcode 2020010006097   Scan available.

2144. Mahavyutpatti  H Mhpohobs; Unknown, 1911, Motilall_Banrsidass_Publishers, 290 pages. Barcode 2020010006099   Scan available.

2145. Mahinmastotramu Madhusuudanii Vyaakhyaa Trxtiiyan' San'skarand-amu  shrimadhusuudanasarasvatii; Language. Linguistics. Literature, 1964, chaukhamba sanskrit series office varanasi, 50 pages. Barcode 5010010028280   Scan not available.

2146. Maitraayand-iiyamaanavagrxhyasuutarman  Ramakrishna Harshaji Sastri; Language. Linguistics. Literature, 1926, Central Library, Baroda, 302 pages. Barcode 5010010029068   Scan not available.

2147. Maitrayani Samhita  Satavalekar; Spiritual Experience And Mysticism, 1941, Government Press Bombay, 597 pages. Barcode 5010010001198   Scan not available.

2148. Majamuuaajaabtaa Phaujadaarii  Not available; Language. Linguistics. Literature, 1891, mun'shii navalakishoor chhaapekhaanei, 482 pages. Barcode 5010010012626   Scan not available.

2149. Majjhi Manikaya Vol 1  Swami Dwarikadas Shastri; Unknown, 1989, Baudda_Bharathi, 280 pages. Barcode 2020010006105   Scan available.

2150. Majjhi Manikaya Vol 2  Swami Dwarikadas Shastri; Unknown, 1990, Baudda_Bharathi, 420 pages. Barcode 2020010006106   Scan available.

2151. Mal'aya Maaruta Part Ii  vi. raaghavan; Language. Linguistics. Literature, 1971, The Central Sanskrit Institute Tirupathi, 166 pages. Barcode 5010010028249   Scan not available.

2152. Malatimadhava  Sri Sheshraja Sharma Shastri; Unknown, 1998, Chowkhamba_Sansrit_Series_Office, 486 pages. Barcode 2020010012375   Server error, availability unknown.

2153. Malavikagnimitram  Pandith Sri Ramchandra Mishra; Unknown, 1951, CHOWKHAMBA SANSKRIT SERIES OFFICE, 274 pages. Barcode 2020010006117   Scan available.

2154. Malavikagnimitram  Sri Ramachandra Mishra; Unknown, 1993, CHOUKHAMBA SANSKRIT SERIES OFFICE,VARANASI, 269 pages. Barcode 2020010012376   Server error, availability unknown.

2155. Malavikagnimitram A Play In Five Acts  -; Unknown, 1949, SANSKRITA SAHITYA SADANA, 164 pages. Barcode 2020010006116   Scan available.

2156. Malavikamitra Naatakamu  -; Language. Linguistics. Literature, 0, gyanprakash mudralaya, 310 pages. Barcode 2020050057964   Scan not available.

2157. malayamaarutan' dhvitiyan' spandan  V.raghavan; Spiritual Experience And Mysticism, 1971, The Central Sanskrit Institute Tirupathi, 170 pages. Barcode 5010010001199   Server error, availability unknown.

2158. mallikaamaastam  vidyaasaagara bhat'at'aacharya; Literature, 1875, Kalakatta Printing Press , Kalakatta, 346 pages. Barcode 5010010092033   Scan available.

2159. Manasa Piyush Sundara Khanda  Sri Anjani Nandan Sharan; Unknown, 999, Geetha_Press, 422 pages. Barcode 2020010006138   Scan available.

2160. Manasollasa Vol Iii  king someswara; Language. Linguistics. Literature, 1961, oriental institute baroda, 330 pages. Barcode 2020050036064   Scan not available.

2161. Manavagrhyasutra Of The Maitrayaniya Sakha  Ramakrishna Harshaji Sastri; Unknown, 1926, Central Library, 318 pages. Barcode 2020010006144   Scan available.

2162. Mand-d'ala Braahmand-opanishhatuu  mahadeva; RELIGION. THEOLOGY, 1896, The Government Branch Press , Mysore, 48 pages. Barcode 5010010042520   Scan not available.

2163. mand-idarpand-a  ta. gand-apatishaastrind-aa; Literature, 1913, Rajakeeya Press, 142 pages. Barcode 5010010092070   Scan available.

2164. mand-isaara  gopiinaatha; Literature, 1914, The Travancore Government Press, 168 pages. Barcode 5010010091927   Scan available.

2165. Mand-isaara Anumaanakhand-d'a  goopiinaatha; Religion. Theology, 1914, government press trivandrum, 173 pages. Barcode 5010010024752   Scan not available.

2166. Mandaaramarandachampuh  Kavi Shriikrxshhnd-aa; Language. Linguistics. Literature, 1924, Nira~naya Sagara~ Presa, 220 pages. Barcode 2030020016546   Scan not available.

2167. mandala brahmanopanishada  mahadeva saastri; Religion, 1899, The Government Branch Press, Mysore, 44 pages. Barcode 5010010087195   Scan not available.

2168. Mandukya Upanished  V.g. Apte; Upanishads, 1921, Anandasharma Mudranalaya, 235 pages. Barcode 5010010001211   Scan not available.

2169. Manmahaabhaaratamu Bhiishhmaparva 6  t'ii aara krxshhnd-achaarya; Language. Linguistics. Literature, 1828, javaajii daadaajii nirnd-ayasaagaramudrand-aalayamu mun'baapuryaan', 804 pages. Barcode 5010010018003   Scan not available.

2170. manmathavijayaakhyan' naat'akam  ven'kat'araaghavaachaaryend-a; Literature, 1869, Nirnayasagar Press , Mumbai, 366 pages. Barcode 5010010092004   Scan not available.

2171. Manoramaashabdaratna Praqs-aittaraava Liipradhamakhand-d'an  shrii raajanaaraayand-a shaastri; Language. Linguistics. Literature, 0, Chowkamba Samskruta Siries Office,Varanasi, 50 pages. Barcode 5010010028273   Scan not available.

2172. Manormaratnavivek Vol Iv  Sri Harish Shankar Sharmana; Unknown, 999, MOTILAL SANSKRIT HINDI PUSTAK PRAKASHAK, 114 pages. Barcode 2020010006185   Scan available.

2173. Manthrardha Deepika  Sri Shathragna Mishra; Unknown, 999, Jayakrishandas_Haridas_Gupta, 230 pages. Barcode 2020010006189   Scan available.

2174. mantraarthadiipikaa  Not available; Literature, 1867, Not available, 266 pages. Barcode 5010010092138   Scan available.

2175. Mantraayechandodaya  Pandit. Damodar Jha; Language. Linguistics. Literature, 1941, Sri Chandrachuda Singh Bhadur Mahopadya, 456 pages. Barcode 5010010029031   Scan not available.

2176. Mantramahaidadhigrandhahaa  Unknown; Language. Linguistics. Literature, 999, Unknown, 554 pages. Barcode 5010010010772   Scan not available.

2177. Mantraratna Manjushhaa  trivikramabhat't'aaraka; Language. Linguistics. Literature, 1926, The Nirnaya Sagar Press , Mumbai ., 110 pages. Barcode 5010010012625   Scan not available.

2178. Mantroddhaarakosha Saubhaagya Tantrashcha  shriidaqs-ind-aamuurti; Language. Linguistics. Literature, 1979, shriishrxn'geri jagadguru sanaatana dharmasaamityaa, 163 pages. Barcode 5010010024754   Scan not available.

2179. Manu Smruti  manu; Religion. Theology, 0, nirnaya sagar, 790 pages. Barcode 2020050036052   Scan not available.

2180. Manusambhava  ke. sheishhasharma; Language. Linguistics. Literature, 1968, Andhra Pradesh Sahitya Academy Samsthan, 151 pages. Barcode 5010010028274   Scan not available.

2181. Manuscripts  Not available; Language. Linguistics. Literature, 0, Not available, 350 pages. Barcode 5010010018004   Scan not available.

2182. Manuscripts  Not available; Language. Linguistics. Literature, 0, Not available, 645 pages. Barcode 5010010018031   Scan not available.

2183. manusmaruthihi  Malkuluka Bhatta; Literature, 1831, Tukaram Bawaji Mumbai, 551 pages. Barcode 5010010005276   Server error, availability unknown.

2184. Manusmruthi  -; Unknown, 999, -, 184 pages. Barcode 2020010006195   Scan available.

2185. Manusmrxte  Not available; Language. Linguistics. Literature, 0, Not available, 638 pages. Barcode 5010010017783   Scan not available.

2186. manusmrxti  Sri Rameswara Bhatt; SOCIAL SCIENCES, 1916, Tukaram Javaji, 414 pages. Barcode 5010010031483   Server error, availability unknown.

2187. Manusmrxtivishhayaanukramand-ikaa  shriikrxshhnd-adaasaatmaja; Language. Linguistics. Literature, 1948, shriivenkat'eshvaranaamanijayan'tramu, 502 pages. Barcode 5010010012624   Scan not available.

2188. Manusmuuti Vol I  gan'ganatha jaha; LANGUAGE. LINGUISTICS. LITERATURE, 1932, The Asiatic Society , Calcutta, 539 pages. Barcode 5010010042538   Scan not available.

2189. Maraat'i Gran'thaan'chii Bayaajavaara Yaadi Bhaaga Nowlaa  Unknown; Language. Linguistics. Literature, 1940, Sanskrit Mahal Library,Tanjavore, 427 pages. Barcode 5010010010770   Scan not available.

2190. Marcandeya Purana  -; Unknown, 999, -, 702 pages. Barcode 2020010006199   Scan available.

2191. Markandeya Samhita  -; Unknown, 1984, T.T.D Tirupati, 306 pages. Barcode 2020010006201   Scan available.

2192. Matangaliilaa  ta gand-apatishaastri; LANGUAGE. LINGUISTICS. LITERATURE, 1910, the travancore government press , trivandrum, 56 pages. Barcode 5010010078229   Scan available.

2193. Maunt'ast'uara~t'a Elfinst'ana Saaheba Yaan'chen' Chariitra Pura~vaara~dha  God'abole Krxshhnd-aajiiballaala; Geography. Biography. History, 1911, Daamodara San'valaaraama Aand-i Man'd'alii, 333 pages. Barcode 2030020016386   Scan not available.

2194. maurmaasaa paribhaashhaa  Not available; Literature, 1871, Not available, 36 pages. Barcode 5010010091935   Scan available.

2195. Mayadprajaichariu  Hira Lal Jain; Literature, 1962, Bhartiya Gyan Peeth, kashi, 185 pages. Barcode 5990010044053   Server error, availability unknown.

2196. Mayurasandesa  Dr C Kunhan Raja; Unknown, 1944, ORIENTAL BOOK AGENCY, 178 pages. Barcode 2020010006235   Scan available.

2197. Mayuura Sandesha  Raajaa Kun'haana; Philosophy. Psychology, 1944, Saradesaaii, 203 pages. Barcode 2030020016159   Scan not available.

2198. Medhdutam  Kashmorey Dwij Sri Prannath Pandith; Unknown, 999, SRI KABIKINDAKRCHKRAVTRIRNA MUDRITAM, 128 pages. Barcode 2020010006236   Scan available.

2199. medinii  shriijiivaananda vidyaasaagarabhat'at'aachaarya; Literature, 1871, Kalakatta Printing Press , Kalakatta, 266 pages. Barcode 5010010092003   Scan available.

2200. Mediniikosha  gan'ganatha; LANGUAGE. LINGUISTICS. LITERATURE, 1940, Jaya Krishna Das Hari Das Gupta , Benares, 238 pages. Barcode 5010010042552   Scan not available.

2201. Megh Dootam  Sri Haridas Siddhanta Vagosha Bhatta Charya; Unknown, 999, -, 274 pages. Barcode 2020010006248   Scan available.

2202. Meghaduta of Kalidasa Text With English Translation amp Notes  G.r.nandargikar; Unknown, 2001, New Bharatiya Book Corporation Delhi, 308 pages. Barcode 5010010001237   Scan not available.

2203. Meghadutam  Sri vidyanth Jha; Unknown, 2002, Krishnadas_Akadami_Varanasi, 335 pages. Barcode 2020010012507   Server error, availability unknown.

2204. Meghasandesa  kalidasa; Language. Linguistics. Literature, 1909, sri vani vilas press, 216 pages. Barcode 2020050057974   Scan not available.

2205. Meghavijayopadhyayas Digvijaya Mahakavya  -; Unknown, 2001, Bharatiya_Vidhya_Bhavan, 200 pages. Barcode 2020010006247   Scan available.

2206. Mevad'a Patana  raamachandra; LANGUAGE. LINGUISTICS. LITERATURE, 1948, Hindi Grantha Prasaraka , Bombay, 120 pages. Barcode 5010010042463   Scan not available.

2207. miimaan'saa nyaaya prakaasha raashht'hrabhaapaamayii baalatoshhind-ii vyaakhyaaya  shriiaapadeva; LANGUAGE. LINGUISTICS. LITERATURE, 1983, shriilaalabahaaduurashaastrii kendriyasan'skrxta vidhyaapiit'hamu nuutanadillii, 48 pages. Barcode 5010010023334   Server error, availability unknown.

2208. miimaan'saabhyudayan  Tatacharya,d.t; Philosophy, 1925, The district Board Tanjore, 246 pages. Barcode 5010010007213   Scan not available.

2209. Miimaan'saadara~shanama~  Jaimini; Philosophy. Psychology, 1948, Vi Ji Joshii Da Prajna Presa~, 583 pages. Barcode 2030020016344   Scan not available.

2210. Miimaan'saadarshanamuu  kevalaanandasarasvatii; LANGUAGE. LINGUISTICS. LITERATURE, 1948, Prajnapathasala Mandala , Satara, 570 pages. Barcode 5010010042488   Scan not available.

2211. Miimaan'saadarshani  shrimajjaimini; Religion. Theology, 1934, aanandaashramamudrand-aalaya, 405 pages. Barcode 5010010024765   Scan not available.

2212. Miimaan'saakoshha Part 3  kevalaanandasarasvatii; LANGUAGE. LINGUISTICS. LITERATURE, 1954, Prajnapathasala Mandala , Satara, 740 pages. Barcode 5010010042505   Scan not available.

2213. Miimaan'saakoshha Part Ii  kevalaanandasarasvati; LANGUAGE. LINGUISTICS. LITERATURE, 1953, Prajnapathasala Mandala , Satara, 613 pages. Barcode 5010010042563   Scan not available.

2214. Miimaan'saakoshha Part Iv  kevalaanandasarasvatii; LANGUAGE. LINGUISTICS. LITERATURE, 1956, Prajnapathasala Mandala , Satara, 1021 pages. Barcode 5010010042479   Scan not available.

2215. miimaan'saanyaayaprakaasha  mahaadevasharmand-aa; Literature, 1911, Nirnayasagar Press , Mumbai, 88 pages. Barcode 5010010092102   Scan available.

2216. Miimaan'saanyaayaprakaasha Aapodevii  aapadeva; Religion. Theology, 1914, nirnd-ayasaagarasvyamudrand-aalaya mumbayyaan', 90 pages. Barcode 5010010024766   Scan not available.

2217. Miimaan'saanyaayaprakaasha Saaravivechinyaakhyaayaa  shriimadaapadeva; Language. Linguistics. Literature, 0, chaukhamba sanskrit series office, benares, 238 pages. Barcode 5010010025648   Scan not available.

2218. Miimaan'saanyaayaprakaasha Saaravivechinyaakhyaayaa  shriimadaapadeva; Language. Linguistics. Literature, 0, chaukhamba sanskrit series office, benares, 214 pages. Barcode 5010010025649   Scan not available.

2219. miimaan'saaparibhaashhaa  shriiharidaasaguptena; Literature, 1903, Vidyavilas Chapkhana, 283 pages. Barcode 5010010091928   Scan not available.

2220. Miimaan'saaprakarand-agrantha Miimaan'saanyaayaprakaasha T'ippand-yaadisamalan'krxta  aapadeva; Language. Linguistics. Literature, 1943, nirnayasagar press, bombay, 96 pages. Barcode 5010010025650   Scan not available.

2221. Miimaan'saashlokavaartikama  shriimatkrxmaarilabhat't'a; Language. Linguistics. Literature, 1898, taaraa yantraalayamu kaashyaamuu, 554 pages. Barcode 5010010017784   Scan not available.

2222. Miimaan'saashlokavaartikamu Nyaayaratnaakaraaravyayaa Vyaakhyayaa  shriimatkumaarilabhat't'apaada; Language. Linguistics. Literature, 1898, chaukhambha sanskrit sansthan, vaaraand-asi, 210 pages. Barcode 5010010024767   Scan not available.

2223. Miimaan'sasaarasang-graha  shriishang-karabhat't'a; Language. Linguistics. Literature, 1961, kaashyamu vidhyaavilaasanaamniyantraalaya, 48 pages. Barcode 5010010026039   Scan not available.

2224. Miimam'saashaastrasavasve  Halayudha; Philosophy. Psychology, 1931, Not Available, 86 pages. Barcode 5010010029986   Scan not available.

2225. mimaan'saamand-d'anena mand-id'ataa  Ganganatha Jha; , 1928, Chowkamba Sanskrit Series Office, Benaras, 531 pages. Barcode 5010010007215   Scan not available.

2226. Mimaan'saanukramand-ika  mandana mishra; General, 1930, The Chowkamba Sanskrit Series Office, Benaras, 541 pages. Barcode 5010010024770   Scan not available.

2227. Mimaan'saanukramand-ikaa  not available; Language. Linguistics. Literature, 1930, Vudya Vilas Press, Varanasi, 536 pages. Barcode 5010010028258   Scan not available.

2228. Mimaan'sha Darshanam Pada I  sabhara bhaasya; Language. Linguistics. Literature, 1980, Chaukhamba Surbharati Prakashan, Varanasi, 142 pages. Barcode 5010010028259   Scan not available.

2229. Mimamsabalaprakasha Of Sri Bhatta Shankara  Sri Mukunda Shastri; Mimamsa Shastram, 1902, sri Babu Haridasagupta,Kashi, 195 pages. Barcode 5010010001240   Scan not available.

2230. Miman'sadarshanei  not available; General, 0, Travancore Government Press, Trivandrum, 798 pages. Barcode 5010010024771   Scan not available.

2231. Minorworks Of Ksemendra  E.v.v.raghavacharya; Unknown, 1961, The_Sanskrit_Academy, 632 pages. Barcode 2020010006270   Scan available.

2232. Mishra bandhu vinod  Ganesh Bihari Mishra, Shyam bihari Mishra, Shukadev Bihari Mishra; Literature, 1970, Hindi grantha prakashak Manda, Prayag, 540 pages. Barcode 5990010044054   Server error, availability unknown.

2233. Mishrabandhuvinoda Bhaaga 1  Not Available; LANGUAGE. LINGUISTICS. LITERATURE, 1970, Hindi Grantha Prasaraka , Bombay, 453 pages. Barcode 5010010042308   Scan not available.

2234. Mishrabandhuvinoda Bhaaga 3  Not Available; LANGUAGE. LINGUISTICS. LITERATURE, 1970, Hindi Grantha Prasaraka , Bombay, 501 pages. Barcode 5010010042402   Scan not available.

2235. Mitaaqs-araat'iikaayaa  Not available; Language. Linguistics. Literature, 0, Not available, 130 pages. Barcode 5010010025959   Scan not available.

2236. Mitralaab  ramnaraya lal beni madhav; Language. Linguistics. Literature, 1961, ramnaraya lal beni madhav alhabad, 228 pages. Barcode 2020050036080   Scan not available.

2237. mnut'iikaasad'gahan  Julius Jolly; Literature, 1986, The Asiatic Society Calcutta, 320 pages. Barcode 5010010005281   Server error, availability unknown.

2238. Moqs-akaand-d'amu Chatudaisho Bhaagan  K.v.rangaswami; Language. Linguistics. Literature, 1943, Oriental Institute,Baroda, 433 pages. Barcode 5010010024659   Scan not available.

2239. Mrcchakatika of Sudraka  Jaya Shankar Lal Tripathi; Unknown, 2002, Krishnadas_ Academy, 760 pages. Barcode 2020010012569   Server error, availability unknown.

2240. Mruchhakatikamu  shrudrakavi; Language. Linguistics. Literature, 1937, -, 394 pages. Barcode 2020050036036   Scan not available.

2241. Mruschakatika  Shalaram Dwivedi; Unknown, 1982, Vishwavidyalay_Prakashan, 374 pages. Barcode 2020010006311   Scan available.

2242. mrxchchhakat'ikam  kaashiinaatha paand-d'uran'ga parava; Literature, 1857, Nirnayasagar Press , Mumbai, 273 pages. Barcode 5010010092043   Scan not available.

2243. mrxchchhakat'ikamuu  kaashiinaatha paand-d'uran'ga paraba; Literature, 1826, Nirnayasagar Press , Mumbai, 306 pages. Barcode 5010010092084   Scan available.

2244. Mrxchchhakat'ikei  Not Available; Language. Linguistics. Literature, 1882, Not Available, 433 pages. Barcode 5010010012560   Scan not available.

2245. Mrxgaang-kalekhaa Naatikaa  Deva~ Shriivishvanaatha; Language. Linguistics. Literature, 1929, Vidhyaa Vilaasa Presa~, 94 pages. Barcode 2030020016440   Scan not available.

2246. Mrxgendragam  bhatta naaraayand-akaant'a; Religion. Theology, 1962, Institut Francais Dindologie, Pondichery, 390 pages. Barcode 5010010024772   Scan not available.

2247. Muchchhakat'ikan  varashudrakaraaja; Language. Linguistics. Literature, 1893, Central Book Depot, Mumbai, 580 pages. Barcode 5010010032883   Scan not available.

2248. Mudra Rakshasam  Saradaranjanray Vidyavinode; Unknown, 1918, Kumudranjan_Ray, 690 pages. Barcode 2020010006316   Scan available.

2249. mudraaraakshhasam  Not available; Literature, 1869, Not available, 380 pages. Barcode 5010010091940   Scan available.

2250. mudraaraaqs-ase  Visadhadatta; Linguistics Literature, 1918, Pandurang Jawaji, Bombay, 382 pages. Barcode 5010010005325   Server error, availability unknown.

2251. Mudraaraaqs-ase Pradhamo Kand'khaha  Visakadatta; General, 1918, Pandurang Jawaji Bombay, 382 pages. Barcode 5010010012667   Scan not available.

2252. Mudrakshasa  -; Language. Linguistics. Literature, 0, -, 386 pages. Barcode 2020050036352   Scan not available.

2253. Mudraraaqs-asa Prathama San'skarand-ama~  Vishaakhadatta; Language. Linguistics. Literature, 1915, Nira~nd-aya Saagara~ Presa~, 49 pages. Barcode 2030020015972   Scan not available.

2254. Mudraraksasa  visakhadatta; Language. Linguistics. Literature, 1948, r s walimbe, 466 pages. Barcode 2020050057968   Scan not available.

2255. Mudraraksasa First Edition  -; Unknown, 999, -, 372 pages. Barcode 2020010006314   Scan available.

2256. Mudrarakshasa  Kastnath Trimbak Telano; Mimamsa Shastram, 1923, Nirnaya Sagar Press Bombay, 381 pages. Barcode 5010010001262   Server error, availability unknown.

2257. Mudrarakshasa Or The Signet Ring A Sanskrit Drama In Seven Acts  Visakhadatta; Language. Linguistics. Literature, 1923, The Oriental Book Supplying Agency, Poona, 330 pages. Barcode 5010010009643   Scan not available.

2258. Mudrarakshasam  Dr Ramashankar Tripathi; Unknown, 1969, VISHWAVIDHYALAY PRAKASHAN, 302 pages. Barcode 2020010006315   Scan available.

2259. Mugdhabodha Vyaakarand-ama~ Vol I  Deva Vopa; LANGUAGE. LINGUISTICS. LITERATURE, 1912, Not Available, 140 pages. Barcode 2030020032381   Scan available.

2260. Mugendraagaman  N R Bhatt; Language. Linguistics. Literature, 1962, Institute Francais Dindologie , Pondichery ., 380 pages. Barcode 5010010012546   Scan not available.

2261. Muhatri Chintamani  khemraj Shri krishnadas; Unknown, 1879, Sri Venkatadra Stream Press, 174 pages. Barcode 2020010006320   Scan available.

2262. Muhhuurtachintaamand-i  narayana acharya; General, 2005, satyabhamabhai panduranga prakashika, 492 pages. Barcode 2020050017187   Scan available.

2263. Muhoorta Depika  gagaavishhnd-a shriikruushhnd-adaasa; Religion. Theology, 1937, Kalyana, 62 pages. Barcode 2020050017234   Scan available.

2264. Muhurta Chintaamand-i  naaraayand-araam aachaarya; Language. Linguistics. Literature, 1945, Nirnaya Sagar Mudranalaya, Mumbai, 490 pages. Barcode 5010010028276   Scan not available.

2265. Muhurtha Chintamaani  jyeshtarama mukandaji; Unknown, 999, Mumbayya javaji dadaji, 384 pages. Barcode 2020010006321   Scan available.

2266. muhutairatnamu  Sripada Bhat,a; Astrology, 1999, Varahamihira Publications,Tirupati, 330 pages. Barcode 5010010007235   Scan not available.

2267. Muhuurtachintaamand-i Pramitaaqs-araat'iikaasameta  shriiraamaachaarya; Language. Linguistics. Literature, 1850, laqs-miiveng-kat'eshvara st'iimu presa mun'bayii, 336 pages. Barcode 5010010025960   Scan not available.

2268. Muhuurtadarpand-amu  vavilla rama swamy sastrylu and sons; General, 2005, vavilla rama swamy sastrylu and sons, 180 pages. Barcode 2020050017200   Scan available.

2269. Mukttipradiipa  Not available; Language. Linguistics. Literature, 0, Not available, 30 pages. Barcode 5010010024778   Scan not available.

2270. Mukundaanandabhaand-an  shriikaashipati; Language. Linguistics. Literature, 1894, Tukaram Javaji,Bombay, 82 pages. Barcode 5010010032878   Scan not available.

2271. mulaavidhaa bhaashhyavaartikavirudva  Kastnath Trimbak Telano; Mimamsa Shastram, 1975, Adhyatma Prakasha Mysore, 138 pages. Barcode 5010010001264   Server error, availability unknown.

2272. mulagadaadhariyo shabdakhand-d'an  Sri Gadadara Battacharya; , 1904, Sudarsana Mudrakshara Sala, 107 pages. Barcode 5010010007227   Scan not available.

2273. Mulamadhya Makakarikas  Valle Poussin; Unknown, 1992, Motilall_Banrsidass_Publishers, 674 pages. Barcode 2020010006329   Scan available.

2274. Mumuksu Savasvaasaraa Sangrahaa  Unknown; Language. Linguistics. Literature, 999, Unknown, 156 pages. Barcode 5010010010767   Scan not available.

2275. Mund-d'akopanishhata~ Grantha 9  Aapat'e Hari Naarayand-a; Philosophy. Psychology, 1927, Aanandaa Shramamudrand-aalaye, 78 pages. Barcode 2030020016014   Scan not available.

2276. Mundaka Upanishad  swami satchidanandendra saraswati; Language. Linguistics. Literature, 1882, adhyatma prakasha karyalaya,holenarsipur, 146 pages. Barcode 5010010017941   Scan not available.

2277. Muuhuurtamaartan'd'a Maartad'avallabhaaravyavyaakhyaasahita  Not available; Language. Linguistics. Literature, 1925, Not available, 128 pages. Barcode 5010010025962   Scan not available.

2278. muulaavidyaaniraasa'  kushhnd-asvaami; Religion, 1921, , 274 pages. Barcode 5010010087223   Scan not available.

2279. Muulaavidyaniraasa  ke e krxshhnd-asvaani ayyara; Language. Linguistics. Literature, 0, Not available, 274 pages. Barcode 5010010017955   Scan not available.

2280. Muulavidayaa Niraasa  subramanyasharmand-a; Language. Linguistics. Literature, 0, Not Available, 278 pages. Barcode 5010010024783   Scan not available.

2281. My Prayers Vol.3  -; Unknown, 1969, Shri Ram Batra, 92 pages. Barcode 2020010006339   Scan available.

2282. Mysticism And Symbolism In Aitareya And Taittiriya Aranyakas  Dr.b.d.dhawan; Unknown, 1988, Gian Publishing House, 236 pages. Barcode 2020010006340   Scan available.

2283. Myths And Races Of The World  C.chakraberti; Unknown, 1985, Puja_Publishers, 210 pages. Barcode 2020010006341   Scan available.

Return to the top

N


2284. N-iithimaalai  Ku.N-at'eichan-aat't'aar; Literature, 1835, Vinayakar Press, Velore, 20 pages. Barcode 5010010084091   Scan not available.

2285. Na Ii Hindii Rachana Pahalaa Bhaaga  Not Available; LANGUAGE. LINGUISTICS. LITERATURE, 2000, Dakshina Bharath Hindi Prachara Sabha , Madras, 84 pages. Barcode 5010010042310   Scan not available.

2286. Naa Mahaaraashht'ra Yaatra  saahityabhuushhand-a shriijonnalagad'd'a satyanaaraayand-amuurti; Language. Linguistics. Literature, 1951, chennapuri vaavil'la raamasvaamishaastrulu an'd' sans, 274 pages. Barcode 5010010028263   Scan not available.

2287. Naagaananad  sivarama; PHILOSOPHY. PSYCHOLOGY, 1911, The Superndent Government Press,Trivandrum, 318 pages. Barcode 5010010078771   Scan available.

2288. Naagakumaaracharita  Pushhpadanta Mahaakavii; Language. Linguistics. Literature, 1933, Baalatkaraagana Jaina Pablikashana~ Sosait'ii, 290 pages. Barcode 2030020015998   Scan not available.

2289. Naagapura Praan'taacha Itihaasa  Maadhavakaale Yaadava; Geography. Biography. History, 1934, Yaadava Maadhavakaale, 680 pages. Barcode 2030020016369   Scan not available.

2290. Naagarasara~vasva Kaamashaastrakaa Apuura~va Gran'thaa  Pada~mashrii; Technology, 1926, Shriinaaraayand-aa Prin't'in'ga Vara~ksa, 194 pages. Barcode 2030020016320   Scan not available.

2291. naageshaashayanind-aiyan' pradhamo skandhahan  Narayana Sastrigal; Geography. Biography. History, 1913, No, 77 pages. Barcode 5010010005347   Server error, availability unknown.

2292. Naamalid'agaanushaasanama~  Bhat't'a Qs-irasvaami; Language. Linguistics. Literature, 1941, Oriend-t'ala Buka Ejansi, 567 pages. Barcode 2030020016160   Scan not available.

2293. Naamalid'ganushaasan' Naama Kosha  Chintamani Shastri; LANGUAGE. LINGUISTICS. LITERATURE, 1882, Government Central Book Depo , Bombay, 460 pages. Barcode 5010010078362   Scan available.

2294. naamalid'ganushaasanan' naamakosha  amarasin'ha; Literature, 1896, Rajakeeya Press, 362 pages. Barcode 5010010092100   Scan available.

2295. naamalid'gnushaasanan'  shriimadamarasin'ha; Literature, 1914, Rajakeeya Press, 220 pages. Barcode 5010010091933   Scan not available.

2296. naamalid'gnushaasanan' dwitiiya kaand'a  ta. gand-apatishaastriind-aa; Literature, 1915, Rajakeeya Press, 402 pages. Barcode 5010010091963   Scan available.

2297. Naamamaalaa  Dhanj-jaya Mahaakavi; Language. Linguistics. Literature, 1950, Bhaaratiiya Jnaanapiit'ha Kaashii, 178 pages. Barcode 2030020016552   Scan not available.

2298. Naanaara~tha San'grah Grantha 10  Chintaamand-i Ti Raa; Language. Linguistics. Literature, 1937, Puriya Vishva Vidhaalaya, 173 pages. Barcode 2030020016033   Scan not available.

2299. naanaarthaarnd-avasan'kshhepa  ta. gand-apatishaastriind-aa; Literature, 1913, Rajakeeya Press, 114 pages. Barcode 5010010092022   Scan available.

2300. naanaarthaarnd-avasan'kshhepa dwitiiya kaand'a  ta. gand-apatishaastriind-aa; Literature, 1913, Rajakeeya Press, 190 pages. Barcode 5010010091958   Scan available.

2301. naanaarthaarnd-avasan'kshhepa trxtiiya kaand'a  ta. gand-apatishaastriind-aa; Literature, 1913, Rajakeeya Press, 234 pages. Barcode 5010010091946   Scan available.

2302. Naanaartharnd-avasan'qs-eipa  ta gand-apatishaastrii; Language. Linguistics. Literature, 0, Not Available ., 518 pages. Barcode 5010010012559   Scan not available.

2303. Naanaathara~ San'grah  Chintaamand-i; Language. Linguistics. Literature, 1937, Not, 170 pages. Barcode 2030020016062   Scan not available.

2304. Naaraayand-aguro San'skrxtakrxtayaa  Naaraayand-aguro; Religion. Theology, 1933, Naaraayand-agurukula, 67 pages. Barcode 2030020016367   Scan not available.

2305. Naaraayand-iiyan  naaraayand-abhat't'a; Religion. Theology, 1912, the travancore government press trivandrum, 396 pages. Barcode 5010010017785   Scan not available.

2306. naaradapancharaatran  K.krishna Das; Literature, 1962, V.Ramaswamy Sastrulu amp Sons,Madras, 216 pages. Barcode 5010010001286   Server error, availability unknown.

2307. Naaradhiya Mahaapuraand-amu  Unknown; Language. Linguistics. Literature, 1980, Unknown, 724 pages. Barcode 5010010010766   Scan not available.

2308. Naasikeita Paakhyaanamu  -; Language. Linguistics. Literature, 0, -, 54 pages. Barcode 2020050058011   Scan not available.

2309. Naat'akachandrikaa  baabulaal shukla; Language. Linguistics. Literature, 1964, Chowkambha Samskruta Sirij Office, Varanasi, 220 pages. Barcode 5010010028251   Scan not available.

2310. Naat'a~yadara~pand-ama~ Prathamo Bhaaga  Gunasaan'dra and Raamachandra; Natural Sciences, 1929, Ji Ela~ Shah~ Aananda~ Presa, 276 pages. Barcode 2030020016542   Scan not available.

2311. Naat'uuyadarpand-amu Prathamoo Bhaaga  raamachandra; Language. Linguistics. Literature, 1929, oriyant'ala inisht'it'yuut'a, 267 pages. Barcode 5010010012557   Scan not available.

2312. Naat'yadarpeind-amuu Volume 1  raamachandra; Language. Linguistics. Literature, 1929, Oriental Institute , Baroda ., 270 pages. Barcode 5010010012556   Scan not available.

2313. Naat'yashaastramu Vivrxtisametamu Bhaaga 1  bharatamuni; Language. Linguistics. Literature, 1956, oriental institute, baroda, 584 pages. Barcode 5010010026040   Scan not available.

2314. Naathamaadhava Trot'aka Charitra Va Aat'havand-ii  Baalakrxshhnd-akulakara~nd-ii Purushhottama~; Geography. Biography. History, 1953, Baalakrxshhnd-akulakara~nd-ii Purushhottama~, 162 pages. Barcode 2030020016417   Scan not available.

2315. Naatyashaastram  bharata; The Arts, 1927, jai krishnadas haridas gupta varnasi, 550 pages. Barcode 2020050036345   Scan not available.

2316. Nagananda  -; Language. Linguistics. Literature, 0, -, 460 pages. Barcode 2020050036353   Scan not available.

2317. Nagananda Edition I I  P V Ramanuja Swami; Unknown, 1934, V RAMASWAMY SASTRULU AND SONS, 492 pages. Barcode 2020010006361   Scan available.

2318. Nagananda Natakam  Pandith Sri Guru Prasad Shastry; Unknown, 2005, BHARGAV PUSTAKALAY, 358 pages. Barcode 2020010006363   Scan available.

2319. Nagari Pracharini Granthamala Series No. 4-10  Chand baradai; Literature, 1962, Sagar Pracharini Sabha, Delhi, 131 pages. Barcode 5990010044055   Server error, availability unknown.

2320. Nagari Pracharini Granthamala Series No. 4-6  Chand baradai; Literature, 1906, Sagar Pracharini Sabha, Delhi, 135 pages. Barcode 5990010044056   Server error, availability unknown.

2321. Nagari Pracharini Granthamala Series No. 4-8  Chand baradai; Literature, 1906, Nagar Pracharini Sabha, Delhi, 132 pages. Barcode 5990010044057   Server error, availability unknown.

2322. Nagari Pracharini Granthamala Series No. 4-8  Chand baradai; Literature, 1906, Nagar Pracharini Sabha, Delhi, 111 pages. Barcode 5990010044058   Server error, availability unknown.

2323. Nagari Pracharini Granthamala Series No. 4-9  Chand baradai; Literature, 1907, Nagar Pracharini Sabha, Delhi, 168 pages. Barcode 5990010044059   Server error, availability unknown.

2324. Naisadhiyacaritam Of Mahakkavi Sriharsa  Dr Devarshi Sanadhya Shastri; Unknown, 999, Krishnadas_Academy_Varanasi, 1331 pages. Barcode 2020010012624   Server error, availability unknown.

2325. Naisadhiyacharitham Canto12 22 Uttarardha  Dr.devarshi Sandhya Shastry; Unknown, 1987, Krishnadas_Academy, 1469 pages. Barcode 2020010012625   Server error, availability unknown.

2326. Naishaddhiya Charita  Kaviatan Pandit Shiv Dutta; Unknown, 1927, The_Shri_Venkateshwar_Steam_Press, 790 pages. Barcode 2020010006371   Scan available.

2327. Naishhadhakaavya  kheimaraaja shriikrxshhnd-adaasane; Language. Linguistics. Literature, 1817, shriivenkat'eshvaraa mudraalaye, 184 pages. Barcode 5010010012623   Scan not available.

2328. Naishhadhakaavyam Vyaakhyayaa Sameitam  mahaakavi shriiharshha; Language. Linguistics. Literature, 1932, chennapuryaam vaanil'l'a raamasvaamishaastrulu an'd' sans, 242 pages. Barcode 5010010024795   Scan not available.

2329. naishhadhiiyacharitam  jaavajii daadaajii; Literature, 1896, Not available, 1087 pages. Barcode 5010010091955   Scan not available.

2330. naishhadhiiyacharitamuu  daadhiichapand-d'itashivadattasharmand-a; Literature, 1907, Nirnayasagar Press , Mumbai, 554 pages. Barcode 5010010092147   Scan available.

2331. Naishhakarmya Sidhdhi  chan'drika; Language. Linguistics. Literature, 1903, Government Central Book Depo,Bombay, 265 pages. Barcode 5010010025082   Scan not available.

2332. Naishkarmya Siddhi  shri suresvaracarya; Language. Linguistics. Literature, 2005, adhyatma prakasha karyalaya, holenarsipur, 612 pages. Barcode 5010010017942   Scan not available.

2333. nalachampuu  trivikramabhat'at'a; Literature, 1867, Nirnayasagar Press , Mumbai, 292 pages. Barcode 5010010091990   Scan available.

2334. nalacharitranaat'akamu  Sankara Rama Sastri C; Literature, 1925, Balamanorama Press Madras, 135 pages. Barcode 5010010005349   Server error, availability unknown.

2335. Nalooparavyaanamuu  Not available; Language. Linguistics. Literature, 0, Not available, 380 pages. Barcode 5010010017786   Scan not available.

2336. Nalopakhyanam  Dr Jagdamba Prasad Sinha; Unknown, 999, Akhil_Bharateey_Sanskrith, 452 pages. Barcode 2020010006379   Scan available.

2337. Nalopakhyanam  vyasa; Language. Linguistics. Literature, 1965, chowkhamba sanskrit series office varanasi, 366 pages. Barcode 2020050036381   Scan not available.

2338. Nalopakyanam Dwithiya Khandah  Jagdamba Prasad Sinha; Unknown, 999, Akhil_Bharathiy_Samskruth_Parishad, 206 pages. Barcode 2020010006380   Scan available.

2339. Namalinga Sasanam  amarasimhudu; Language. Linguistics. Literature, 1940, oriental book regency poona, 204 pages. Barcode 2020050057976   Scan not available.

2340. Namalinganusasana Alias Amarakosa Of Amarasimha  m m pandit sivadatta dadhimatha; Unknown, 1984, chaukamba sanskrit series, 554 pages. Barcode 2020010006382   Scan available.

2341. Namamalikaa Bhojaa  Kulakara~nd-ii Ekanaatha Dattaatreya; Language. Linguistics. Literature, 1955, Esa Ema Kaatare, 129 pages. Barcode 2030020016092   Scan not available.

2342. Nanartha Samgraha  Anundoram Borooah; Unknown, 1969, PUBLICATION BOARD ASSAM, 562 pages. Barcode 2020010006386   Scan available.

2343. Nanarthasangraha Of Ajayapala  T R Chintamani; Language. Linguistics. Literature, 1937, University Of Madras, Madras, 162 pages. Barcode 5010010009644   Scan not available.

2344. Nandisuttram  shri devavaccaka; Language. Linguistics. Literature, 1966, prakrit text society, 252 pages. Barcode 2020050036405   Scan not available.

2345. Nanj-avaada Nanj-avaadasan'gn-akayinaddigajatna T'ikayaa  shriimachchhiromand-isudhii; Language. Linguistics. Literature, 1899, videhadeshaalaya, kaashyaan', 90 pages. Barcode 5010010026059   Scan not available.

2346. Nanjarajayasobhusana Of Abhinava Kalidasa  embar krishnamacharya; Unknown, 1930, oriental insitute, 340 pages. Barcode 2020010006388   Scan available.

2347. Naradh Puraye  -; Unknown, 999, -, 506 pages. Barcode 2020010006393   Scan available.

2348. Narakasuravijaya Vyayoga  dharmasuri; Language. Linguistics. Literature, 1961, the sanskrit academy osmaniya university hyderabad, 84 pages. Barcode 2020050057973   Scan not available.

2349. Naranaaraayand-aanandamahaakaavyamuu  C.D.Dalal; LANGUAGE. LINGUISTICS. LITERATURE, 1916, Central Library , Baroda, 122 pages. Barcode 5010010078823   Scan available.

2350. Narapatijayacharyaasvarodaya Jayalaqs-miit'iikaasameta  shriimannarapatikavi; Language. Linguistics. Literature, 1956, shriiven'kat'eshvara st'iimu presa, bambayii, 292 pages. Barcode 5010010026060   Scan not available.

2351. Narasin'gapuraand-amu  shriimadvedavyaasa; Language. Linguistics. Literature, 1911, mumbayyaan' gopaal'a naarayand-a kan'panii, 254 pages. Barcode 5010010024902   Scan not available.

2352. Narasinha Puranam  Dr.r.s.saini; Unknown, 1986, Eastern_Book_Linkers, 420 pages. Barcode 2020010006397   Scan available.

2353. Narayaniya Of Narayana Bhatta  K Sambhasiva Sastri; Unknown, 1934, The_Superintendent_Government_Press, 392 pages. Barcode 2020010006400   Scan available.

2354. Narayankruthvruthisametamashrav Layan Shauthsutram  Hari Narayan Aapte; Unknown, 1917, Ananda_Sham_Mudranalay, 474 pages. Barcode 2020010006401   Scan available.

2355. Nareshvarapariksha  Ramakantha; Unknown, 1926, Printed At The Kashmir Pratap Steam Press, 300 pages. Barcode 2020010006403   Scan available.

2356. Natya Sastra Of Bharatamuni 3  Dr.ravishankar Nagar; Unknown, 1994, Parimal_Publications, 367 pages. Barcode 5010010001293   Scan not available.

2357. Natya Sastra Sangraha Vol I  Sri K Vasudeva Sastri; Unknown, 1953, Sarawathi_Mahal_Library, 772 pages. Barcode 2020010006424   Scan available.

2358. Natya Sastra Sangraha Vol Ii  K Vasudeva Sastri; Unknown, 1961, S_Gopalan, 218 pages. Barcode 2020010006423   Scan available.

2359. Natyasastra  sri bharatamuni; The Arts, 1943, satyabhamabai pandurang bombay, 676 pages. Barcode 2020050036365   Scan not available.

2360. Natyasastra Of Baratamuni,abhinavabharati 1  Dr.r.s.nagar; Unknown, 1994, Primal_Publications,Delhi, 446 pages. Barcode 5010010001294   Scan not available.

2361. Natyasastra Of Bharatamuni Vol Iv  Abhinavaguptacarya; Unknown, 1984, The_Superintenernt_Government_Press, 560 pages. Barcode 2020010006422   Scan available.

2362. Natyasastra With The Commentary Of Abhinavagupta Vol 3  m ramakrishna kavi; Unknown, 1954, oriental insitute, 344 pages. Barcode 2020010006425   Scan available.

2363. Natyasastra With The Commentary Of Abhinavagupta Vol-iii  m.ramakrishna kavi; Language. Linguistics. Literature, 1954, oriental institute, 350 pages. Barcode 2020050058037   Scan not available.

2364. Natyashasrta Of Bharathamuni Vol I I  Abhinava Gupta Charya; Unknown, 1984, Parimal_Publications, 422 pages. Barcode 2020010006428   Scan available.

2365. Natyashasrta Of Bharathamuni Vol Iii  Abhinava Gupta Charya; Unknown, 1983, Parimal_Publications, 366 pages. Barcode 2020010006427   Scan available.

2366. Naushada Charitam  -; Language. Linguistics. Literature, 0, -, 1506 pages. Barcode 2020050036062   Scan not available.

2367. Naushhadhacharitam  mahaakavi sriihshhiivirachitamuu; LANGUAGE. LINGUISTICS. LITERATURE, 1860, kaalakaataangayayaamuu sarasvatiiyasei mudreitamuu, 680 pages. Barcode 5010010078725   Scan available.

2368. Naushhadhiiyacharitamuu  Not Available; LANGUAGE. LINGUISTICS. LITERATURE, 1907, daadhiichapand-id'atashivadattashamiind-aa, 554 pages. Barcode 5010010078760   Scan available.

2369. Naushhaghacharitamuu  mahaakavi srihashhiivirachitamuu; LANGUAGE. LINGUISTICS. LITERATURE, 1860, kalikaataanagayayiimuu naarayargayantrei mudiireitamuu, 820 pages. Barcode 5010010078201   Scan available.

2370. Navagiitaakusumaanj-jali  c. venkataramaniah; Language. Linguistics. Literature, 0, Not available, 18 pages. Barcode 5010010024805   Scan not available.

2371. Navaratnavidhapadhathi  Sri Daivagyadunichandratmajapandit; Unknown, 999, Sri_Venkateshwar_Steem_Press, 144 pages. Barcode 2020010006448   Scan available.

2372. Nayaayaamrutamu Dhvitiyo Bhaagan  Krishnacharya,t.r; Unknown, 1908, Nirnaya Sagar Press,Mumbai, 365 pages. Barcode 5010010010761   Scan not available.

2373. nayaayakusumajjalii  T.viraraghavacharya; Natural Sciences, 1967, Longmans_Green_And_Company_Ltd, 179 pages. Barcode 5010010005383   Server error, availability unknown.

2374. Nayachandrikaa Praaramyate  Unknown; Language. Linguistics. Literature, 999, Unknown, 133 pages. Barcode 5010010010762   Scan not available.

2375. Nayadhyumand-i  meighanaadaarisuuri; Language. Linguistics. Literature, 1956, Government Oriental Manuscripts Library , Chennai ., 456 pages. Barcode 5010010012622   Scan not available.

2376. Nayadviveka  Bhavanatha Misra; Philosophy. Psychology, 1937, University Of Madras, 320 pages. Barcode 5010010029973   Scan not available.

2377. nayamanjarii  Srimad Appaya Diksita; Philosophy. Psychology, 1941, Sri Sankara Gurukulam, Sri Rangam, 246 pages. Barcode 5010010026463   Scan not available.

2378. Nayaviveika  bhaavanaatha mishraa; Language. Linguistics. Literature, 1937, University Of Madras , Chennai ., 330 pages. Barcode 5010010012621   Scan not available.

2379. Nayaviveka  se . kuu. raamanaathashaastri; LANGUAGE. LINGUISTICS. LITERATURE, 1937, University Of Madras , Madras, 321 pages. Barcode 5010010042585   Scan not available.

2380. Neetisataka  swetaranyam narayana sastriar; Language. Linguistics. Literature, 1951, v ramaswamy sastrulu adn sons madras, 174 pages. Barcode 2020050036357   Scan not available.

2381. Neiminirvaana  vaagbhatta; Language. Linguistics. Literature, 1936, nirnd-ayasaagaraakhyamudraalaya, mumbayyaan', 127 pages. Barcode 5010010028197   Scan not available.

2382. Ng-aapakaasan'grahamuu  nagesha bhatta; Language. Linguistics. Literature, 1972, kendriya sanskrit vidhyapeetam, 248 pages. Barcode 5010010018005   Scan not available.

2383. Nidraa Vign-aana Kyon' Kahaan' Kaise Aura Kaba Sonaa Chaahiye  pan' prabhunaaraayand-a tripaat'hii sushiila; Language. Linguistics. Literature, 1967, sarasvatii sadana, prayaaga, 86 pages. Barcode 5010010026881   Scan not available.

2384. Nighantusesa  acharya hemachandrasuri s; Unknown, 1968, lalbhai dalpatbhai bharatiya sanskriti vidyamandira, 420 pages. Barcode 2020010006507   Scan available.

2385. niilakand-t'havijaya  shriimanniilakand-t'hadiiqs-ita; LANGUAGE. LINGUISTICS. LITERATURE, 1941, sri balamanorama press madras, 454 pages. Barcode 5010010026557   Server error, availability unknown.

2386. niilakand-t'havijayan  C.shankara Rama Sastri; Linguistics Literature, 1941, The Sri Balamanorama Press,Madras, 140 pages. Barcode 5010010005369   Server error, availability unknown.

2387. Niilamatapurand-ama~  Rama~lala~ Kanjilala~ Yama~ Hecha~; Social Sciences, 1924, Motilala Banara~si Dasa~ Punjaba~ San'skrxta~buka~ D'ipot'a~, 230 pages. Barcode 2030020016230   Scan not available.

2388. niitimaalaa  Narayanarya; Philosophy. Psychology, 1940, Not Available, 226 pages. Barcode 5010010026462   Scan not available.

2389. Niitimayuukha  Bhatta Nilakantha; Social Sciences, 1925, J.R. Gharpure, Bombay, 86 pages. Barcode 5010010027992   Scan not available.

2390. Niitipaat'han  Pandith Priyanath Vidyabhushan; Philosophy. Psychology, 1926, Pandit Sitanath Vidyabinode, 76 pages. Barcode 5010010027991   Scan not available.

2391. niitisaara  ta. gand-apatishaastriind-aa; Literature, 1912, Rajakeeya Press, 346 pages. Barcode 5010010092038   Scan available.

2392. Nilakanthavijaya  C.sankara Ramashastri; Unknown, 1941, The Sri Balamanorama Press, 146 pages. Barcode 2020010006514   Scan available.

2393. nipaataavyayopasagaivuttin  P V Ramanujaswami; Linguistics Literature, 1951, Sri C Anna Rao, 85 pages. Barcode 5010010005370   Server error, availability unknown.

2394. nipaataavyayopasagraivuttin' t'ilaka  Someswara Sarma. A; Literature, 1951, T.T.D Tirupati, 76 pages. Barcode 5010010007271   Scan not available.

2395. Nir^nd-ayaamrxtamam  Thallahtanath Pandit; Social Sciences, 1827, Sri Krishnadas, 286 pages. Barcode 5010010033884   Scan not available.

2396. Nir^nd-ayasindhau  Vasudeva Sarma; Social Sciences, 1926, Pandurang Javaji, 482 pages. Barcode 5010010033903   Scan not available.

2397. Nirakttama Da~vitiiyo Bhaaga  Shriimadhyaaskaachaaraya; Language. Linguistics. Literature, 1926, Aannandaashramamudrand-aalayan', 764 pages. Barcode 2030020015995   Scan not available.

2398. Nira~nd-aya Sindhu  Bhat't'a Kamalaakara; Religion. Theology, 1949, Nira~nd-aya Saagara, 471 pages. Barcode 2030020016177   Scan not available.

2399. Nirnayasin'd'hu  jvaalaapraasaada mishra; Language. Linguistics. Literature, 0, Not available, 625 pages. Barcode 5010010012544   Scan not available.

2400. Nirnayasindu  shrii kamlakar bhatt; Language. Linguistics. Literature, 1940, satyabhamabai pandurang bombay, 480 pages. Barcode 2020050036376   Scan not available.

2401. Nirnaysindhu Vol Ii  Sri Kamalakar Bhatt; Unknown, 1986, Chowkhamba_Sanskrith_Series_Office, 748 pages. Barcode 2020010006526   Scan available.

2402. Niruktam  Pandith Shivduttsharma; Unknown, 999, Sri_Venkateshwar_Steem_Press, 972 pages. Barcode 2020010006528   Scan available.

2403. niruktamuu  shriijiivaanandavidyaasaagara bhat'aachaaryaa; Religion, 1921, , 443 pages. Barcode 5010010087182   Scan not available.

2404. Niruktan' Dditiiyo Bhaaga  Makara Bhad'aka; Language. Linguistics. Literature, 1942, Baambai Saan'skrxta, 556 pages. Barcode 2030020016201   Scan not available.

2405. Niruktan' Nighand-t'upaat'hasamupetan' Dvitiiyobhaaga  shriimadhyaarakaachaarya; Religion. Theology, 1942, bhaand-d'aarakarapraachyavidhyaasan'shodhanamandiraa, 545 pages. Barcode 5010010024831   Scan not available.

2406. Niruttk Bhaashhyat'iikaa  Mahesvara; Language. Linguistics. Literature, 1927, University Of Punjab, 158 pages. Barcode 5010010029794   Scan not available.

2407. Niruttkalaghuvivrxti Panj-chapaadikaa  shriimanmaharshhivarayaaskiiya; Language. Linguistics. Literature, 1912, nirnayasagar press, bombay, 166 pages. Barcode 5010010024832   Scan not available.

2408. Niruttkmn  Mahamuni Vyasakcharya; Language. Linguistics. Literature, 1918, Not Available, 768 pages. Barcode 5010010029789   Scan not available.

2409. Nishkarma Siddhi  Sri Prem Vallbh Tripatisha Thran; Unknown, 2007, Sreshti_Pravar_Srigouri_Shankar, 204 pages. Barcode 2020010006531   Scan available.

2410. Nispannayogavali  Bhattacharya; Literature, 1949, ORIENTAL INSTITUTE, BARODA, 222 pages. Barcode 5010010001308   Scan not available.

2411. Niteshatakam  Sri Madanthram Shastry; Unknown, 999, CHOUKHAMBA SANSKRIT SERIES OFFICE,VARANASI, 219 pages. Barcode 2020010012754   Server error, availability unknown.

2412. Nitidvishashtika  Sundara Pandya; Unknown, 1928, MANI MANJARI PUBLICATIONS, 64 pages. Barcode 2020010006534   Scan available.

2413. Nitiprakashika  Vaisampayana; Unknown, 1953, The_Superintendent_Government_Press, 135 pages. Barcode 2020010006536   Scan available.

2414. Nitiprakasika  Gustav Oppert; Unknown, 1985, EASTERN BOOK SELLERS, 96 pages. Barcode 2020010006537   Scan available.

2415. nitisataka  kasinatha trimbaka telanga; Religion, 1893, Education Society Press, Bombay, 174 pages. Barcode 5010010087232   Scan not available.

2416. Nitya Kamya Karma Mimamsa  Remella Suryaprakasa Shastri; Unknown, 1990, R.k.printers, 328 pages. Barcode 2020010006541   Scan available.

2417. Nitya Kamya Karma Mimamsaa  Remella Suryaprakasa Sastri; Unknown, 1990, R.k.Printer's, 332 pages. Barcode 2020010006540   Scan available.

2418. nityaachaaradapaind-an  Brahmanandaji; Literature, 1949, Sri Poornanand Press Banaras, 91 pages. Barcode 5010010001309   Server error, availability unknown.

2419. Nityaachaarapradiipa Part I  Narasimha Vajapeyin; Social Sciences, 1907, Asiatic Society Of Bengal, 746 pages. Barcode 5010010033828   Scan not available.

2420. nityaachaarapradopan  Narasimha Vijapeyt Vol Ii; Literature, 1928, THE ASIATIC SOCIETY OF BENGAL, CALCUTTA, 768 pages. Barcode 5010010007276   Scan not available.

2421. Nityotsava Vol Iii  Mahadeva Sastri; Literature, 1948, ORIENTAL INSTITUTE, BARODA, 216 pages. Barcode 5010010001310   Scan not available.

2422. nityotsavan  A.mahadeva Sastri; Religion. Theology, 1930, Oriental Institute Baroda, 283 pages. Barcode 5010010001311   Server error, availability unknown.

2423. Niyatakaalakaand-d'amu Trutiyo Bhaagan  K.v.rangaswami; Language. Linguistics. Literature, 1950, Oriental Instirute, Baroda, 649 pages. Barcode 5010010024664   Scan not available.

2424. Nrisinha Prasada Tritha Sara  Gopinath Kaviraj; Literature, 1936, SANGVED VIDYALAYA PRESS ,BENARESS, 153 pages. Barcode 5010010001306   Scan not available.

2425. Nrsimhtyasya Prayoga Parijatasya Sodasa Samskara Kandam Pakasamstha Kanda Samksepasla  Tukaram Javaji; Unknown, 1916, Nirnaya Sagar Press, Mumbai, 971 pages. Barcode 5010010010764   Scan not available.

2426. Nrxgamooqs-aprabandha  naaraayana bhat't'aa; Language. Linguistics. Literature, 1955, Suranad Kunjan Pillai , Trivandrum ., 68 pages. Barcode 5010010012620   Scan not available.

2427. Nrxsin'hapuuvauttarataa Paniiyopanishhata~  Aapat'e Gand-osha Vinaayaka; Religion. Theology, 1929, Aanandaa Shramamudrand-alaye, 186 pages. Barcode 2030020016068   Scan not available.

2428. Nrxtta San'grng-aha  d'aa priyabaala shhaa; Language. Linguistics. Literature, 1956, Rajasthan Oriental Research Institute , Jaipur ., 68 pages. Barcode 5010010012555   Scan not available.

2429. Nuutanadhrmmaniyamasya  Not available; Language. Linguistics. Literature, 1962, sin'halasthashcha vaaiveila sosaait'ii, 622 pages. Barcode 5010010012619   Scan not available.

2430. nyaaya jaagadiishiivyadhikarand-amu  0000; Religion. Theology, 0, 0000, 299 pages. Barcode 5010010005355   Server error, availability unknown.

2431. Nyaaya Kumuda Chandra Dditiiyo Bhaaga  Kumaara Nyaayaachaara~ya Mahendra; Religion. Theology, 1941, Naathuuraama Premii, 666 pages. Barcode 2030020016104   Scan not available.

2432. Nyaaya Muktaavali Raaghavendra Yati  Unknown; Unknown, 999, Unknown, 421 pages. Barcode 5010010010763   Scan not available.

2433. Nyaaya Parishuddii  lakqs-mand-aachaaryand-a; Language. Linguistics. Literature, 1923, Chowkhamba Sanskrit Series Office, Benares, 534 pages. Barcode 5010010028266   Scan not available.

2434. nyaayaashiddhaajnaamuu  Not Available; Philosophy. Psychology, 1935, Sri Vaishnava Siddhanta PracharasabhamLtd, Madras, 426 pages. Barcode 5010010026461   Scan not available.

2435. Nyaayabhaashhyavaarttikataapyarya Vivarand-apanj-jikaa 2 5  anuruddhaachaarya; Language. Linguistics. Literature, 1969, mithilaavidhyaapiit'ha, darbhaan'ga, 91 pages. Barcode 5010010024835   Scan not available.

2436. Nyaayabhaaskarakhand-d'anama~  Shastrii Raamasubramand-yama~; Philosophy. Psychology, 1919, Hecha~ D'ii Guptaa en'd'a~ Sansa~, 216 pages. Barcode 2030020016404   Scan not available.

2437. Nyaayabindu  Shriidhara~mottaraa Chaara~ya; Philosophy. Psychology, 1954, Chaukhambaa San'skrxta Siirija, 184 pages. Barcode 2030020016339   Scan not available.

2438. nyaayabindu qs-idhamakiirti prand-iita  Chandrashekhar Shastri; Philosophy. Psychology, 1924, Jayakrishnadas Gupta, Benares, 222 pages. Barcode 5010010026460   Scan not available.

2439. Nyaayabodhinii Niilakan't'hiiya Vishhauamaalaa  Sri Kamakshi Amma; Philosophy. Psychology, 1912, Sri Kamakshi Amma, 90 pages. Barcode 5010010030000   Scan not available.

2440. Nyaayabodhinii Vaakyavrxtti Nirukti  Not available; Religion. Theology, 0, Not available, 444 pages. Barcode 5010010024836   Scan not available.

2441. Nyaayaboodhini Baakyavrxtti  pat't'aabhiraama; Language. Linguistics. Literature, 0, Not available, 432 pages. Barcode 5010010018006   Scan not available.

2442. Nyaayadarshana Suutras Bhasya  gautama; Religion. Theology, 1925, chaukhamba sanskrit series office, benares, 1010 pages. Barcode 5010010026064   Scan not available.

2443. nyaayadarshanam  shriiyukta jayanaaraayand-a; Literature, 1865, Kalakatta Printing Press , Kalakatta, 634 pages. Barcode 5010010092005   Scan not available.

2444. Nyaayadarshanamu Bhaashhya Vrxttisahitamu  vaatsayaayanamuni; Language. Linguistics. Literature, 1919, kaalikaataamahaanagaryyamu vaachaspatyayantramu, 350 pages. Barcode 5010010026063   Scan not available.

2445. Nyaayakaalaapasang-agraha  shriiseneshvaraaryai; Language. Linguistics. Literature, 0, shriinivaasaraaghava, 96 pages. Barcode 5010010018062   Scan not available.

2446. nyaayakalaapasan'graha  Sri Senesvaracharya; Philosophy. Psychology, 1940, A. Srinivasa Raghavan, Pudukotah, 94 pages. Barcode 5010010026459   Scan not available.

2447. nyaayakosha  mahaamahopaadhyaaya bhiimaachaaryend-a; Literature, 1893, Nirnayasagar Press , Mumbai, 567 pages. Barcode 5010010091982   Scan available.

2448. nyaayakulishamu  Athreya Ramanuya; Saktism, 1938, SANSKRIT DEPARTMENT ANNAMALAI UNIVERSITY,MADRAS, 291 pages. Barcode 5010010007279   Scan not available.

2449. nyaayakulishamuu  Atreya Ramanuja; Philosophy. Psychology, 1938, Annamalai University Philosophy Series, 298 pages. Barcode 5010010026458   Scan not available.

2450. nyaayakusumaajjali  shrii udayanaachaaryaa; Literature, 1912, Vidyavilas Chapkhana, 570 pages. Barcode 5010010092089   Scan available.

2451. Nyaayakusumaan'nj-jali  Shriimadudayaanaachaara~yaa; Philosophy. Psychology, 1940, Tirupatinagarasan'sthaapitaayaa Kusumanj-jalisamityaa, 243 pages. Barcode 2030020016359   Scan not available.

2452. Nyaayakusumaanj-jali Part 2  T. Viraraghavacharya; Philosophy. Psychology, 1941, T. Viraraghavacharya, 178 pages. Barcode 5010010029895   Scan not available.

2453. Nyaayakusumaanj-jali Vol 1  T. Viraraghavacharya; Philosophy. Psychology, 1941, T. Viraraghavacharya, 204 pages. Barcode 5010010029922   Scan not available.

2454. Nyaayakusumaanj-jali Vol I  ti . viiraraaghavachaayaund-a; LANGUAGE. LINGUISTICS. LITERATURE, 1941, THe Srinivasa Press , Tiruvadi, 315 pages. Barcode 5010010042542   Scan not available.

2455. Nyaayaliilaavati  shrii vallabhaachaarya; Language. Linguistics. Literature, 1915, nirnayasagar press, bombay, 118 pages. Barcode 5010010024838   Scan not available.

2456. Nyaayanibandhaavalii  si. shekhara; Language. Linguistics. Literature, 1970, The Hindu Press, Darbhanga, 168 pages. Barcode 5010010028265   Scan not available.

2457. Nyaayaparishuddhi  ven'kat'anaath vedaan'taaachaarya; LANGUAGE. LINGUISTICS. LITERATURE, 1918, Jai Krishnadas gupta,Benares, 546 pages. Barcode 5010010069306   Scan available.

2458. Nyaayaparishuddhi Vol I  sree nigamantha maha desika; LANGUAGE. LINGUISTICS. LITERATURE, 1913, tha brahmavadin press, madras, 420 pages. Barcode 5010010079432   Scan available.

2459. nyaayaparishudin  Venkatanath Sri Vedantacharya; Nyayasar, 1918, Chowkamba Sanskrit Series Office, Benaras, 524 pages. Barcode 5010010007269   Scan not available.

2460. Nyaayaprakaasha Nyaayashaastra  chidaghanaanandagiri; Language. Linguistics. Literature, 1934, laqs-miiveng-kad'eshvara st'iimu presa, 592 pages. Barcode 5010010024839   Scan not available.

2461. nyaayarakqs-aamand-i  Sri Appayah Dikshita; Philosophy. Psychology, 0, Not Available, 379 pages. Barcode 5010010026457   Scan not available.

2462. nyaayarakshhaamand-i  ta. gand-apati shaastriind-aa; Literature, 1897, Sri Vidya Press , Kumbhakonam, 375 pages. Barcode 5010010092171   Scan available.

2463. nyaayarakshhaamand-i'  gand-apatishaastri; Religion, 1905, , 376 pages. Barcode 5010010087242   Scan not available.

2464. Nyaayaratnaakarakhyaavyaakhyaasahite Shlokavaartike  Not available; Religion. Theology, 0, Not available, 461 pages. Barcode 5010010024840   Scan not available.

2465. Nyaayaratnamaala  paarthasaarathimishraa; Language. Linguistics. Literature, 1937, oriental institute, barodaa, 432 pages. Barcode 5010010017787   Scan not available.

2466. nyaayaratnamaalaa  shrii gad'gaadhara shaastriind-aa parishoodhitaa; Literature, 1900, Not available, 568 pages. Barcode 5010010092025   Scan available.

2467. Nyaayaratnamala  Parthasarathi Misra; Philosophy. Psychology, 1937, Benoytosh Bhattacaryya, 426 pages. Barcode 5010010029968   Scan not available.

2468. Nyaayasaara Shrii Bhaasar^vagn-aprand-iita  K.sambashiva Sastri; Philosophy. Psychology, 1931, The Maharaja Of Travencore, 218 pages. Barcode 5010010029939   Scan not available.

2469. Nyaayasudhaa  Someshvara Bhat't'a; Philosophy. Psychology, 1909, Vidhyaa Vilasa Presa~, 849 pages. Barcode 2030020016347   Scan not available.

2470. Nyaayasudhaa Faskikyulasa~9  Bhat't'asomeshvara; Philosophy. Psychology, 1902, Da Vidhyaa Vilaasa Presa~, 872 pages. Barcode 2030020015979   Scan not available.

2471. nyaayasudhaamand-d'anamu  Satyapramotheertha sripada; Dwaita Philosophy, 1953, Venkatesh Raghavendra, Sarvodaya Printing press, 363 pages. Barcode 5010010001326   Server error, availability unknown.

2472. Nyaayasudhaamand-d'anamuu  Not available; Language. Linguistics. Literature, 0, Not available, 364 pages. Barcode 5010010018007   Scan not available.

2473. nyaayasudhaayaam  Not available; Literature, 1895, Not available, 630 pages. Barcode 5010010092174   Scan available.

2474. nyaayatatvaalokan  Kishore Nath Bha; Natural Sciences, 1992, Ganganath Bha Kendriya Sanskrit Vidyapeetha, 716 pages. Barcode 5010010005387   Server error, availability unknown.

2475. Nyasakalpalata  Shukla Sri Raja Narayan Sastry; Unknown, 1938, JAYA KRISHNA DAS HARIDAS GUPTA, 118 pages. Barcode 2020010006565   Scan available.

2476. Nyay Lalavati  Vyallabhacharyya; Unknown, 1929, Vidya_Vilas_Press, 106 pages. Barcode 2020010006598   Scan available.

2477. Nyaya Kumud Chandra Vol-i  Mahendra Kumar Nyaya Shastry; Unknown, 1938, Pandith Nathu Ram Premi, 608 pages. Barcode 2020010006573   Scan available.

2478. Nyaya Lilavati I 1  vallabhacharya; Unknown, 1927, Chowkhambha sanskrit series, 110 pages. Barcode 2020010006574   Scan available.

2479. Nyaya Lilavati Ii 2  vallabhacharya; Unknown, 1927, Chowkhambha sanskrit series, 108 pages. Barcode 2020010006575   Scan available.

2480. Nyaya Lilavati V 5  vallabhacharya; Unknown, 1932, chowkhambha sanskrit series, 102 pages. Barcode 2020010006576   Scan available.

2481. Nyaya Lilavati Vi 6  vallabhacharya; Unknown, 1932, chowkhambha sanskrit series, 110 pages. Barcode 2020010006577   Scan available.

2482. Nyaya Lilavati Vii 7  vallabhacharya; Unknown, 1932, chowkhambha sanskrit series, 102 pages. Barcode 2020010006578   Scan available.

2483. Nyaya Lilavati Viii -8  vallabhacharya; Unknown, 1933, chowkhambha sanskrit series, 112 pages. Barcode 2020010006579   Scan available.

2484. Nyaya Makarandaha  Sri Ananda Bodha Battaraka Charya; Indian Logic, 1907, Chowkamba Sanskrit Book Depot, Benaras., 388 pages. Barcode 5010010001321   Scan not available.

2485. Nyayabhindu  -; Unknown, 1904, Motilal Banarasidass Publishers, 236 pages. Barcode 2020010006569   Scan available.

2486. Nyayabhindu Of Dharmakirti  E.obermiller; Unknown, 1992, Motilal Banarasidass Publishers, 155 pages. Barcode 2020010006567   Scan available.

2487. Nyayabhindu Of Dharmakirti And The Nyayabindutika Of Dharmottara  E.obermiller; Unknown, 1992, Motilal Banarasidass Publishers, 134 pages. Barcode 2020010006566   Scan available.

2488. Nyayabhindutikatippani  -; Unknown, 1909, Motilal Banarsidass Publishers, 58 pages. Barcode 2020010006568   Scan available.

2489. Nyayadarsana  Vishwanathvritti; Unknown, 2000, CHAUKAMBA SANSKRIT PRATISHTAN, 355 pages. Barcode 2020010012777   Server error, availability unknown.

2490. Nyayadarshanamu  Goswamy Damodar Shastry; Unknown, 1992, Chowkhamba_Sanskrit_Series_Office, 41 pages. Barcode 2020010012778   Server error, availability unknown.

2491. Nyayakhosh  bhimacharya jhalakikar; Philosophy. Psychology, 1874, bhimacharya jhalakikar, 1104 pages. Barcode 2020050057972   Scan not available.

2492. Nyayamritakulya  Padamunnur Sri Narayanacharya; Dwaita Philosophy, 1955, Sri_shiruru_Mutt, 119 pages. Barcode 5010010001322   Scan not available.

2493. Nyayamrithaha Sudha Chandrika  Unknown; Language. Linguistics. Literature, 999, Unknown, 115 pages. Barcode 5010010010756   Scan not available.

2494. Nyayamrtatarangini 686  Unknown; Language. Linguistics. Literature, 0, G.R.C press,Madras, 249 pages. Barcode 5010010010636   Scan not available.

2495. Nyayarakshsmani Of Srimad Appayya Deekshithendra  Pandit S.r.krishna Murthy; Unknown, 1971, Srimad_Appayya_Deekshithendra_Granthavali_Prakassana_Samithi, 554 pages. Barcode 2020010006585   Scan available.

2496. Nyayaratna  Maniantha Misra; Unknown, 1953, Government_Oriental_Manusript_Liberary, 422 pages. Barcode 2020010006587   Scan available.

2497. Nyayaratnamala Of Parthasarathimisra  K.s.ramaswami Sastri Siromani; Unknown, 1937, Oriental_Institute, 434 pages. Barcode 2020010006586   Scan available.

2498. Nyayasastra With The Commentary Of Abhinavagupta  m ramakrishna kavi; Unknown, 1934, oriental insitute, 534 pages. Barcode 2020010006589   Scan available.

2499. Nyayasiddantamuktavali Of Viswanathapancanana Bhattacarya  Dr.gajanana Shastri Musalagaonkar; Unknown, 1984, Chaukhamba_Surbharati_Prakshan, 392 pages. Barcode 2020010006592   Scan available.

2500. Nyayasiddhanta Muktavali  Dr. Gajanana Shastri Musalagaonkar; Unknown, 1984, Chaukhamba Surbharati Prakashan, 386 pages. Barcode 2020010006593   Scan available.

2501. Nyayasudha Sesavakyartha Chandrika Chapter 1 Subunit 4  Unknown; Unknown, 999, Unknown, 311 pages. Barcode 5010010010754   Scan not available.

2502. Nyayasutra Of Goutama  gandanatha jha; Unknown, 1939, mala chandra rao, 392 pages. Barcode 2020010006595   Scan available.

2503. Nyaysutravaidikvruthi  Pandith Devdutt Sharmana; Unknown, 999, Balkrishna_Ramchandra_Ghanekaren_Mudrapyitva, 380 pages. Barcode 2020010006599   Scan available.

Return to the top

O


2504. Om Brihat Sarvanukramnika Of The Atharva Veda  Pandit Ramgopala Shastri; Unknown, 1922, Dayanand Mahavidhyalay Sanskrit Grandhmala, 283 pages. Barcode 2020010006608   Scan available.

2505. Original Sanskrit Texts On The Origin And History Of The People Of India Vol I  J Muir; History, 1868, Trubner And Co London, 553 pages. Barcode 2020050022530   Scan not available.

Return to the top

P


2506. paadukaapat't'aabhishhokamu  Rama Murti.k.s; Literature, 1973, S.V.U. Oriental Research Institute Tirupati, 77 pages. Barcode 5010010007299   Scan not available.

2507. Paaia Sadda Mahand-nd-aavo Praakrxta Shabdamahaarnd-ava  Not available; Language. Linguistics. Literature, 0, Not available, 1200 pages. Barcode 5010010026066   Scan not available.

2508. Paand-iniiyavyaakarand-ebhinavavaarttikaani  vishvabhandhu; Language. Linguistics. Literature, 1972, vishveshvaarananda institute hoshiarpur, 38 pages. Barcode 5010010026068   Scan not available.

2509. Paand-inisutravyaakhyaa  Viiraraaghavaachaara~ya Mund-aluura~; Language. Linguistics. Literature, 1954, Gavara~namen't'a~ Orient'ala~ Manuskriipt'a~, 702 pages. Barcode 2030020016220   Scan not available.

2510. paarabhaashondradipikaa  ; Sanskrit Grammer, 999, Motilal Banarasidas, Varanasi, 64 pages. Barcode 5010010007321   Scan not available.

2511. paaribhaashhaavrxtti  ta. gand-apatishaastriind-aa; Literature, 1915, Rajakeeya Press, 66 pages. Barcode 5010010092035   Scan available.

2512. Paaribhaashhikapadaaryasan'graha  kurugand-t'i suryanaaraayand-ashaastri; Language. Linguistics. Literature, 0, Not Available, 172 pages. Barcode 5010010012618   Scan not available.

2513. Paarijaataharanachampu  pandit durgaprasaada; Language. Linguistics. Literature, 1926, Panduranga Jawaji , Mumbai ., 64 pages. Barcode 5010010012617   Scan not available.

2514. Paarijaataharand-achampu  trinaatha sharma; Language. Linguistics. Literature, 1962, Chowkamba Vidhya Bhavan , Varanasi, 175 pages. Barcode 5010010028267   Scan not available.

2515. Paarijaatahrnacampa  saishasrikrishna; Language. Linguistics. Literature, 1900, Tukaram Javaji, Bombay, 408 pages. Barcode 5010010031953   Scan not available.

2516. Paashhara~dasuutrama~  Shaunakamahaamuninaa Bhagavataa; Religion. Theology, 1953, Mahendra Naatha Sarakaarend-a, 83 pages. Barcode 2030020016010   Scan not available.

2517. Paat'hakamukhavispot'akamu  ruupalaala kapuur; Language. Linguistics. Literature, 0, bhaaratii nikunj-jamu madraasu, 258 pages. Barcode 5010010024847   Scan not available.

2518. paat'hashodhanamuu  Sri Koliyalam Swami; Philosophy. Psychology, 1944, Sri Ranga Ramanuja, 88 pages. Barcode 5010010026456   Scan not available.

2519. Paatajjalayogasuutraand-i  hari naaraayand-a aapat'e; LANGUAGE. LINGUISTICS. LITERATURE, 1919, Ananda Mudranalayamu , Madras, 296 pages. Barcode 5010010078216   Scan available.

2520. Paavaitiiparind-ayamu  shriibaand-abhat't'a; Language. Linguistics. Literature, 1902, Tukaram Javaji,Bombay, 56 pages. Barcode 5010010032863   Scan not available.

2521. Pachchatantrakamuu  vishhnd-u sharma; LANGUAGE. LINGUISTICS. LITERATURE, 1930, Jai Krishnada Haridas Gupta , Benares, 204 pages. Barcode 5010010042579   Scan not available.

2522. Padakavya Ratnakara  Anantha Charyar. P.b; Linguistics Literature, 1904, Sri Sudarsana Press, Kanchipuram, 210 pages. Barcode 5010010001372   Scan not available.

2523. padasan'grahan' bhaaga pahilaa  Vamana Daji Oka; Linguistics Literature, 1894, Tukarama Javavji Bombay, 487 pages. Barcode 5010010005414   Server error, availability unknown.

2524. Padhamanjari Dwithiya Bagamu  Sri Haridatta Misra; Unknown, 1981, Sanskrit_Academy, 777 pages. Barcode 2020010006627   Scan available.

2525. Padhamanjari Pradhama Bhagamu  Sri Haridatta Misra; Unknown, 1981, Sanskrit_Academy, 757 pages. Barcode 2020010006628   Scan available.

2526. Padhyapushhpaanj-jali  Aara~yend-a Subrahmand-ya; Philosophy. Psychology, 1951, Shrii Raamakrxshhnd-aa Presa~, 157 pages. Barcode 2030020016436   Scan not available.

2527. Padit Raj Jagannath Mahakavi  K Surya Narayanashastri; Unknown, 1983, T.T.D Tirupati, 134 pages. Barcode 2020010006630   Scan available.

2528. Padmapuraand-amu Tatraadimamaadikhand-d'an' Dvitiiyan' Bhuumikhand-d'an' Chetyetaddvayaruupa Prathamabhaaga  mahaamunishriimadvyaasa; Language. Linguistics. Literature, 1893, aanandaashramamudrand-aalaya, 390 pages. Barcode 5010010026041   Scan not available.

2529. Padmapurand-amuu  mahadeva chimand-aajii aapat'e; RELIGION. THEOLOGY, 1894, Ananda Mudranalayamu , Madras, 570 pages. Barcode 5010010078338   Scan available.

2530. Padukapattabhisekam Of Narayanakavi  Dr K S Rama Murthy; Unknown, 1973, J CHENNA REDDY, 89 pages. Barcode 2020010006640   Scan available.

2531. Padya Mala  Sri Jaya Tirtha; Unknown, 1941, Sriman_Madhva_Siddhanta_Granthalaya,Udupi, 68 pages. Barcode 5010010001373   Scan not available.

2532. Padyachuud'aamand-i  m ranga acharya; LANGUAGE. LINGUISTICS. LITERATURE, 1921, The Superintendent Government Press,Madras, 312 pages. Barcode 5010010078837   Scan available.

2533. Padyamrta Tarangini  Haribhaskara; Unknown, 1941, Dr.jatindra_Bimal_Chaudhuri, 274 pages. Barcode 2020010006644   Scan available.

2534. Pahile Mahaayudhda Bhaaga Tisaraa  Khaad'ilakara Shrii Krxshhnd-aajii Prabhaakara; Geography. Biography. History, 1940, Shriidattatraya Prin't'in'ga Presa~, 132 pages. Barcode 2030020016298   Scan not available.

2535. Pailastyavatham'  k s ramaswamy sastrigal; LANGUAGE. LINGUISTICS. LITERATURE, 1914, Not Available, 158 pages. Barcode 5010010080049   Scan available.

2536. pajjadashii  Ramakrishna; Geography. Biography. History, 1941, Nirnayasagar Mudranalaya,Mumbai, 579 pages. Barcode 5010010005421   Server error, availability unknown.

2537. pajjatantrakam  kaashiinaatha paand-d'uran'ga paarava; Literature, 1824, Nirnayasagar Press , Mumbai, 242 pages. Barcode 5010010091944   Scan available.

2538. Palitipitakasassanukkamanika Part 2  depatment of pali; Vacant, 1983, chaukhamba vidyabhavan varnasi, 338 pages. Barcode 2020050036035   Scan not available.

2539. Palkuriki Somanatha  Dr Smt Mudigonda Uma Devi; Unknown, 1990, RASA GANGOTRI, 252 pages. Barcode 2020010006656   Scan available.

2540. Pan'chaadashi Bai Vidyaarand-ya  not availabe; Language. Linguistics. Literature, 0, Not Available, 538 pages. Barcode 5010010024853   Scan not available.

2541. Pan'chamapushhpama~ Kaavyadvayama~  Sarasvatii Vaasudevaananda; Religion. Theology, 1953, Samara~tha Bhaarata Chhaapakhaanaa, 667 pages. Barcode 2030020016530   Scan not available.

2542. Pan'chamapushhpamu Shriiguruchartrikaavyan' Shriidattachan'puu Sat'iikaa  shriivaasudevaanandasarasvatiit'embesvaami; Language. Linguistics. Literature, 1953, shriigurubhakta vaamana dattaatreya gul'avand-ii puund-e, 654 pages. Barcode 5010010025874   Scan not available.

2543. pan'chaprakriyaa  T.r. Chintamani; Philosophy. Psychology, 1946, University of Madras, 118 pages. Barcode 5010010026454   Scan not available.

2544. Pan'chasan'graha  Shriimadamitagatyaachaara~ya; Religion. Theology, 1927, Shriimand-ikachanda digambarajainagranthamaalaa, 258 pages. Barcode 2030020016236   Scan not available.

2545. Pancaratram  C R Devadhar; Unknown, 1957, ORIENTAL BOOK SELLERS, 152 pages. Barcode 2020010006667   Scan available.

2546. Panchadashagiitaa  khemaraaja shriikrxshhnd-adaasa; Language. Linguistics. Literature, 1818, shriiven'kat'eshvara mudrand-aalaya, 144 pages. Barcode 5010010012616   Scan not available.

2547. panchadashii  Sri Mad Ramakrishna; Philosophy. Psychology, 1918, Tukaram Jawaji, Mumbai, 568 pages. Barcode 5010010026455   Scan not available.

2548. panchaman' pushhyamu  Vidyasekharalu,u; Literature, 1954, NARAYANATANTRI ,UDIPI, 60 pages. Barcode 5010010007304   Scan not available.

2549. Panchampushpam V  Sri P P Vasudevanand Saraswathi Tembeswami; Unknown, 1953, SRI GURU BHAKT VAMAN DATTEREY GULVANI, 660 pages. Barcode 2020010006671   Scan available.

2550. panchapadika  ramasastri bhagavatacharya; Religion, 1891, E.J. Lazarus and Co., Benares, 419 pages. Barcode 5010010087239   Scan not available.

2551. pancharatnakaarikaa  Sri Sadasiva; Philosophy. Psychology, 1939, Sri Sankata Gurukulam, Srirangam, 54 pages. Barcode 5010010026453   Scan not available.

2552. Panchasiddaantikaa  varaaha mihiraa; Language. Linguistics. Literature, 1889, e. j. lazarus and co., benaarasa, 342 pages. Barcode 5010010017788   Scan not available.

2553. Panchatantram Vol Ii  Pandit Bhanu Dattshastri; Unknown, 1952, CHOWKHAMBA SANSKRIT SERIES OFFICE, 230 pages. Barcode 2020010006672   Scan available.

2554. Panchatantramu 1  kielhorna; Language. Linguistics. Literature, 1896, Government Central Book Depot, Bombay, 324 pages. Barcode 5010010032890   Scan not available.

2555. Panditaraaja Kaavyasangraha Complete Works Of Panditaraja Jagannatha  Panditaraaja Jagannatha; Language. Linguistics. Literature, 1958, Osmania University, Hyderabad, 254 pages. Barcode 5010010025876   Scan not available.

2556. Panineeyashtakam Uttaradharm  Pandith Sri Yutagnaduttasastribhi; Unknown, 999, Gurukul_Kagdi_Vishwavidhyalay, 380 pages. Barcode 2020010006702   Scan available.

2557. Panineeyasthakam Poorvadharm  Pandith Sri Yutagnadutt Sastry; Unknown, 999, Gurukul_Mudranalay, 442 pages. Barcode 2020010006703   Scan available.

2558. Panini As A Variationist  S D Joshi; Unknown, 1980, S P BHOSALE UNIVERSITY OF POONA, 334 pages. Barcode 2020010006704   Scan available.

2559. Paninisutra Vyakhya Vol 1 Purvardhamu  Viraraghavacharya; Unknown, 1954, Government_Oriental_Manuscripts_Library, 694 pages. Barcode 2020010006705   Scan available.

2560. Paniniya Shiqs-aa  Ghosha Manamohana; Language. Linguistics. Literature, 1938, University Of Calcutta, 175 pages. Barcode 2030020016027   Scan not available.

2561. Panj-chadashii  shriimadhdighaarand-yamuni; Language. Linguistics. Literature, 1949, nirnd-ayasaagar mudrand-aalayamu, 581 pages. Barcode 5010010012615   Scan not available.

2562. Panj-chalaqs-and-iisarvasve  shriiraamashaastriind-aa; Religion. Theology, 1926, Not available, 162 pages. Barcode 5010010024856   Scan not available.

2563. Panj-chatantramu  Not available; Language. Linguistics. Literature, 0, Not available, 578 pages. Barcode 5010010025877   Scan not available.

2564. Panj-chatantramu  vishhnusharmaa; Language. Linguistics. Literature, 1995, motilal banarasidass publishers private limited delhi, 518 pages. Barcode 5010010025878   Scan not available.

2565. Panj-chavin'shatisaahastrikaa Pranj-aapaaramitaa  Datta Nalinaaqs-a; Religion. Theology, 1934, Luzaaka End-d'a Kampani, 323 pages. Barcode 2030020016149   Scan not available.

2566. Paqs-ataaprakarand-amuu  shivadatta; LANGUAGE. LINGUISTICS. LITERATURE, 1935, Jai Krishnada Haridas Gupta , Benares, 200 pages. Barcode 5010010042504   Scan not available.

2567. Paqs-chimottarashaakhiiyama~ Vaalmiikiiya Raamaayand-ama~ Uttara Kaand-d'ama~  Vaalmiikii; Language. Linguistics. Literature, 1947, Da Vi Vi Aara~ inst'it'uut'a~ Presa~, 374 pages. Barcode 2030020016548   Scan not available.

2568. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Kishhkindha Kaand-d'ama~  Valmiiki; Natural Sciences, 1936, Da Bon'baaya~ Mishiina~ Prasa~ Lahora~, 497 pages. Barcode 2030020016314   Scan not available.

2569. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Yuddha Kaand-d'ama~  Valmiiki; Natural Sciences, 1944, Da Bon'baaya~ Mishiina~ Prasa~ Lahora~ Da Vi Vi Ara~ Inst'it'yut'a~ Presa~, 624 pages. Barcode 2030020016313   Scan not available.

2570. Paraamara~sha Khan'd'a 1  Aan'bekara Vishhnd-ubaapujii; Language. Linguistics. Literature, 1938, Janara~dhana Shang-kara Med'hekara, 173 pages. Barcode 2030020016374   Scan not available.

2571. paraashara san'hitaa  Padmanabhan,s; Parasara Samhita, 2000, Sri Pancharatra Agama Samrakshana Trust,Srirangam, 234 pages. Barcode 5010010007317   Scan not available.

2572. Paraasharadharmasn'hitaa Vyavahaarakaand-d'amu Practhamoodhyaaya  vaamanasharma; Religion. Theology, 1833, Not available, 1105 pages. Barcode 5010010017789   Scan not available.

2573. Parahita Samhita  srinatha pandita; Unknown, 1972, sri venkateswara university, 200 pages. Barcode 2020010006717   Scan available.

2574. Parama Laghu Manjuaha Of Nagesh Bhatt  Pandith Nityananda Panta Parvatiya; Unknown, 1946, JAYA KRISHNADAS HARIDAS GUPTA, 134 pages. Barcode 2020010006721   Scan available.

2575. Parama Samhitha  S Krishnaswami Aiyangar; Unknown, 1940, Oriental_Institute, 506 pages. Barcode 2020010006724   Scan available.

2576. Paramaanandakaavyama~  Paramaananda~; Language. Linguistics. Literature, 1952, Saadhanaa Pesa~ Bharod'aa, 252 pages. Barcode 2030020016551   Scan not available.

2577. Paramaarthabhuushhand-amuu  shrii viiraraaghavaachaaryaind-a; Language. Linguistics. Literature, 1959, Sri Vasthu Mudranalayam , Chennai ., 1114 pages. Barcode 5010010012614   Scan not available.

2578. paramaarthasaara  ta. gand-apatishaastriind-aa; Literature, 1921, Rajakeeya Press, 58 pages. Barcode 5010010092047   Scan not available.

2579. Paramaarthasaara  Abhinava Gupta; Language. Linguistics. Literature, 1916, Pratap Steam Press, Kashmir, 216 pages. Barcode 5010010025080   Scan not available.

2580. Paramaarthasaara  Abhinava Gupta; Language. Linguistics. Literature, 1916, Pratap Steam Press, Kashmir, 56 pages. Barcode 5010010025101   Scan not available.

2581. Paramaarthasaaramu Vivarand-ena Sametamu  shriibhagavadaadisheshha; Language. Linguistics. Literature, 1989, Not available, 114 pages. Barcode 5010010024860   Scan not available.

2582. paramaayesaaran  Sri Bhagavad Adesesha; Philosophy. Psychology, 1911, The Govt of His Highness The Maharaja of Travancore, 60 pages. Barcode 5010010026452   Scan not available.

2583. Paramartha Prakasika  T. Viraraghavacharya siromani; Philosophy, 1940, The Srinevasa Press ,Tiruvadi., 245 pages. Barcode 5010010001388   Scan not available.

2584. paramasan'hitaa  Dr. S. Krishnaswami Aiyangar; Philosophy. Psychology, 1940, Oriental Institute, Baroda, 505 pages. Barcode 5010010026524   Scan not available.

2585. Parameshwarpitha Slokamalika  D.arkasomayaji; Unknown, 1961, D.Arkasomayaji, 172 pages. Barcode 2020010006727   Scan available.

2586. Parasara Dharma Samhita Vol 2 Part 1  sayana madhvacharya; Language. Linguistics. Literature, 1898, government central books depot bombay, 1306 pages. Barcode 5010010017790   Scan not available.

2587. parashuraamakalpautramu  Mahadeva sastry,a; Saktism, 1923, The Central Library,Baroda, 412 pages. Barcode 5010010007319   Scan not available.

2588. parayaayaratnamaalaa  maadhavakaravirachitaa; Language. Linguistics. Literature, 1946, Patna Univerdity,Patna, 144 pages. Barcode 5010010026451   Scan not available.

2589. Paribashendu Sekhara  Harinarayna Apte; Grammer, 1935, , 247 pages. Barcode 2020010021758   Scan available.

2590. Paribhaashendusekharaa  nagojibhatta; Language. Linguistics. Literature, 1868, Indu Prakash press, Bombay, 136 pages. Barcode 5010010032896   Scan not available.

2591. Paribhaashheindu Sheikhar  not available; Language. Linguistics. Literature, 0, Indian Press, Varanasi, 370 pages. Barcode 5010010028268   Scan not available.

2592. Paribhaashheindu Sheikhar 1938  jayadeivasharma mishra; Language. Linguistics. Literature, 1938, Tirabhukti Prakashan, Elahabad, 389 pages. Barcode 5010010025880   Scan not available.

2593. Paribhaashheindu Sheikhar Vyaakarand-a Vibhaagamu  veind-imaadhava shaastri; Language. Linguistics. Literature, 1943, Indian Press, Varanasi, 434 pages. Barcode 5010010025881   Scan not available.

2594. paribhaashhendrashokharan  0000; Philosophy Psycology, 0, 0000, 344 pages. Barcode 5010010005434   Server error, availability unknown.

2595. Paribhashedendushekar  Sri Nagesh Bhatt; Unknown, 999, Vahursikjanmansantoshay_Mudranalay, 436 pages. Barcode 2020010006736   Scan available.

2596. Paribhashendushekar  Tadnujen Sri Manmadhusudansharma; Unknown, 999, Asya_Punarmudranadivishye_Srvadhadhikari, 531 pages. Barcode 2020010006738   Scan available.

2597. Parijaat  Pandith Sri Kapileswar Shastrina; Unknown, 999, CHOWKHAMBA SANSKRITH SANSTHAAN, 582 pages. Barcode 2020010005455   Scan available.

2598. Parijata Natakam  kumaratatacarya; Language. Linguistics. Literature, 1958, gopalan s, 140 pages. Barcode 2020050036386   Scan not available.

2599. Parijataharanachampu  sesha srikrishna; Language. Linguistics. Literature, 1900, tukram javaji bombay, 60 pages. Barcode 2020050036343   Scan not available.

2600. parishhkaaradapaind-an  Sri Venumadhava Sukla; , 1934, JAI KRISHNADAS HARIDAS GUPTA,BENARES, 280 pages. Barcode 5010010007325   Scan not available.

2601. Parishhkaaradarpand-a Saastraarthakalaasahita  vaiyaakarand-ashiromand-i sukla shrii vend-iimaadhavashaastrii; Language. Linguistics. Literature, 1992, chaukhamba sanskrit series office, benares, 282 pages. Barcode 5010010024863   Scan not available.

2602. Pashavalaan'ba Mimaan'sa  vinaayaka gand-eish; Language. Linguistics. Literature, 1923, Ananda Sama Mudranalaya, Poona, 62 pages. Barcode 5010010024867   Scan not available.

2603. Pashht'aalambhamiimaam'saa  Ropahavvamana Sastri; Philosophy. Psychology, 1923, Vinayaka Ganesh Apte, 68 pages. Barcode 5010010029969   Scan not available.

2604. Pashvaalambhamiimaan'saa  Shaastri Vaamana; Religion. Theology, 1923, Aanandaashramamudrand-aalaye, 70 pages. Barcode 2030020016148   Scan not available.

2605. Pashvaalambhamiimaan'saa  vinaayaka gand-esha aapat'e; Language. Linguistics. Literature, 1923, aanandaashramamudrand-aalaya, 202 pages. Barcode 5010010024866   Scan not available.

2606. Pashvalambhammimamsa  vinaayaka gand-eisha aapat'ei; LANGUAGE. LINGUISTICS. LITERATURE, 1923, pund-yaakhayapattnei aannadaashvaamamudrand-aalayei aayasaaqs-raimudrayitavaa, 68 pages. Barcode 5010010078809   Scan available.

2607. Patanj-jalayogasuutraand-i Vaachaspatimishravirachita T'iikaavyaasabhaashhya Sametaani  Kasi Nath Sastri; Philosophy. Psychology, 1904, hari narayan Apte, 292 pages. Barcode 5010010029983   Scan not available.

2608. Patanjali Yoga Sutrani  -; Philosophy. Psychology, 0, -, 280 pages. Barcode 2020050057999   Scan not available.

2609. Pattuppaat't'u San'skrxtaanuvaada  yas n shriiraama deishikana; Language. Linguistics. Literature, 1972, Not Available, 119 pages. Barcode 5010010012554   Scan not available.

2610. Patyadarshii  shriimaddidhaarand-yamuni; Language. Linguistics. Literature, 1949, The Nirnaya Sagar Press , Mumbai ., 585 pages. Barcode 5010010012613   Scan not available.

2611. Persian Sanskrit Grammer  C Kunhan Raja; Unknown, 999, Indian_Council_For_Cultural_Relations, 188 pages. Barcode 2020010006784   Scan available.

2612. petareyabrahmand-amu  srimatsayanacharya; LANGUAGE. LINGUISTICS. LITERATURE, 1916, -, 508 pages. Barcode 2020050088399   Scan available.

2613. Phaladiipikaa Adhyaaya 1 28  mantreshvaraa; Language. Linguistics. Literature, 1937, vi bi soobbiah and sons, bangalore, 470 pages. Barcode 5010010025885   Scan not available.

2614. Philosophy Of Poetry  Narendra Nath Choudari; Unknown, 1959, Motilal_Banarassi_Das, 454 pages. Barcode 2020010006795   Scan available.

2615. Pilibhit ka Sahitiyik Itihaas  Ganesh Shankar Shukla; Literature, 1957, Hindi sahitya Parishad, Pilibhit, 112 pages. Barcode 5990010044060   Server error, availability unknown.

2616. Pindagalachand Suthram  Sri Pindagala Charya; Unknown, 1947, Chowkhamba_Sanskrith_Series_Office, 97 pages. Barcode 2020010006799   Scan available.

2617. Pingala Acharya  Pandita Viswanatha Shastri; Unknown, 1874, -, 252 pages. Barcode 2020010006800   Scan available.

2618. Plane Trigonometry  pandit bapudeva sastri; Unknown, 1916, sri harikrishna das, 172 pages. Barcode 2020010006803   Scan available.

2619. Poona Akhbars Vol Ii  -; Unknown, 1954, The_Central_Records_Office_Hyderabad_Government, 322 pages. Barcode 2020010006831   Scan available.

2620. Post Independence Sanskrit Literature  k r joshi s m ayachit; Unknown, 1990, vishwa bharathi prakashan, 334 pages. Barcode 2020010006836   Scan available.

2621. Praachiina Gurjaara Kaavyasan'graha , Bhaag I  c d dalal; LANGUAGE. LINGUISTICS. LITERATURE, 1920, central library , baroda, 156 pages. Barcode 5010010078331   Scan available.

2622. praachiinalekhamaalaa prathama bhaaga  pand-d'ita durgaaprasaadena; Literature, 1892, Nirnayasagar Press , Mumbai, 252 pages. Barcode 5010010092146   Scan available.

2623. praakrutamand-idipan  T.t.srinivasagopalacharya; Vaishnavism, 1953, Government Branch Press, Mysore, 101 pages. Barcode 5010010005487   Server error, availability unknown.

2624. Praakrutapingalasutraand-i  laqs-minaadabhat'a; Language. Linguistics. Literature, 1894, tukaram javaji, Bombay, 259 pages. Barcode 5010010032005   Scan not available.

2625. Praakrxta Pushhkarind-ii Prastaavanaa Sahita  d'aakt'aru jagadiishachandra jaina; Language. Linguistics. Literature, 1961, chaukhambaa vidhyaabhavana vaaraand-asii, 116 pages. Barcode 5010010026015   Scan not available.

2626. Praakrxtasarvasvamu  Not available; Language. Linguistics. Literature, 0, Not available, 174 pages. Barcode 5010010028269   Scan not available.

2627. Praakrxtashabdapradiipikaa  Nrxsin'hashaastrii; Language. Linguistics. Literature, 1913, Sanskrxta~ Akademii, 132 pages. Barcode 2030020016204   Scan not available.

2628. Praaryavidhaanamuu  pand-d'ita vishveishvaranaaya reit'ha; Language. Linguistics. Literature, 0, Marvad Printing Press Limited , Jodhapur ., 365 pages. Barcode 5010010012612   Scan not available.

2629. Praathamika San'giita  pro shan'kara gand-eisha vyaasa; The Arts, 1940, Sangeet Prakashan Mandal , New Delhi ., 71 pages. Barcode 5010010012553   Scan not available.

2630. Praayashrvittendushekharah  Bhat't'a Naagojii; Religion. Theology, 1931, Aanandashramamudrand-aalaye, 181 pages. Barcode 2030020016251   Scan not available.

2631. Praayashvattamayuukha Dashaman  shriibhat't'aniilakand-t'ha; Language. Linguistics. Literature, 1862, gujaraatii print'in'ga presa mun'bayii, 292 pages. Barcode 5010010028257   Scan not available.

2632. Prabandaha Cintamani Of Merutungacharya Part I  Jinavijaya Muni; Unknown, 1933, The Adhisthata Singhi Jaina Jnanapitha Santiniketan, 164 pages. Barcode 2020010006843   Scan available.

2633. Prabandhakosha Prathama Bhaaga  Vijaya Jina; Religion. Theology, 1935, Adhishht'haataa Sin'ghii Jaina Nj-aanapiit'ha, 186 pages. Barcode 2030020016182   Scan not available.

2634. Prabhaavakacharita Prathama Bhaaga Muula grantha  Shriiprabhaachandraachara~yaa; Language. Linguistics. Literature, 1940, San'chaalaka Sin'ghii Jaina Granthamaalaa, 261 pages. Barcode 2030020016537   Scan not available.

2635. Prabhakaradijaya  Sri Ramnath Sastri; Philosophy. Psychology, 1926, Samskrita Sahityaparishat, 134 pages. Barcode 5010010029926   Scan not available.

2636. Prabhanda Chinthamani Of Merutungacharya Part 1  Jinavijaya Muni; Unknown, 1933, The_Adhistata_Singhi_Jaina_Jnanapitha, 164 pages. Barcode 2020010006849   Scan available.

2637. Prabhodhanaachandrodayama~  Shriigovindaamrxbhagavaana~; Philosophy. Psychology, 1936, Raajakiiyamudrand-ayantraalaye, 252 pages. Barcode 2030020016535   Scan not available.

2638. Prabhu Lingaleela  Mallikarjuna Shastri; Unknown, 999, -, 160 pages. Barcode 2020010006854   Scan available.

2639. Prabodhachandrodayama~  Mishra Krxshhnd-a; Technology, 1935, Nira~naya Saagara~ Presa~, 265 pages. Barcode 2030020016432   Scan not available.

2640. Prabodhachandrodayamu Chandrikaavyaakhyaa Prakaashaakhyavyaakhyaabhyaan' Shhashht'haavrxtti  shriimatkrxshhnd-amishrayati; Language. Linguistics. Literature, 1935, nirnayasagar press, bombay, 256 pages. Barcode 5010010024887   Scan not available.

2641. Prabodhachandrodayamuu  raamadaasa; LANGUAGE. LINGUISTICS. LITERATURE, 1935, Pandurang Jawaji , Bombay, 252 pages. Barcode 5010010042543   Scan not available.

2642. Prachina Sanskrit Natak  Ramaji Upadyaiah; Unknown, 1994, Chaukhamba_Publications, 484 pages. Barcode 2020010012960   Server error, availability unknown.

2643. Pracya Pascattyam  swmi vivekananda; Philosophy. Psychology, 1968, sitanath goswamy, 132 pages. Barcode 2020050036085   Scan not available.

2644. Pradhama Padyamala  Sri Harishanker Mishra; Unknown, 1975, Motilal_Banarassi_Dass, 142 pages. Barcode 2020010006865   Scan available.

2645. Pradhikaara Kaa Prashna  bhagavatiiprasaada vaajapeiyii; Language. Linguistics. Literature, 1973, esa chanda end-d'a kampanii limit'ed'a, 160 pages. Barcode 5010010012611   Scan not available.

2646. pragnaapaaramitaasa pradhamo bhaagan  B. Bhattacharyya; Philosophy. Psychology, 1932, Gaekwads Oriental Series, Baroda, 674 pages. Barcode 5010010026523   Scan not available.

2647. Prajna Paramitha Ratnaguna Samcaya Gatha  E.obermiller; Unknown, 1992, Motilal Banasidas Publishers, 128 pages. Barcode 2020010006879   Scan available.

2648. Prajnapaaramitaas Abhisamayalankaaralooka Bhaaga 1  b. bhattacharya; Language. Linguistics. Literature, 1932, oriental institute, baroda, 670 pages. Barcode 5010010026018   Scan not available.

2649. Prajnaparamitasa~ Prathama Bhaaga Abhisamayaalad'a~kaaralokah  Haribhadraa; Language. Linguistics. Literature, 1932, Gaekvad'a~sa Orient'ala~ Siriisa~, 676 pages. Barcode 2030020016225   Scan not available.

2650. Prakaasha Shriimadbhaagavatadashamaskandha  shriipurushhottamajiisahaaraaja; Religion. Theology, 1915, chaukhambha sanskrit sansthan, vaaraand-asi, 285 pages. Barcode 5010010024891   Scan not available.

2651. Prakarand-apajjikaa  mukunda; LANGUAGE. LINGUISTICS. LITERATURE, 1908, Not Available, 308 pages. Barcode 5010010042484   Scan not available.

2652. prakat'aathaivivarand-amu  T.r.chinatamani; Buddhism, 1935, UNIVERSITY OF MADRAS,MADRAS, 612 pages. Barcode 5010010007364   Scan not available.

2653. Prakiirnd-aaprabandhaa Prathama Khand-d'a  pand-t'itapravara shriiraamaavataarasharma; Language. Linguistics. Literature, 1956, mithilaavidhyaapiit'ha, 246 pages. Barcode 5010010026019   Scan not available.

2654. Prakrita Sarvasva  krishna chandra acharya; Language. Linguistics. Literature, 1968, prakrit text society ahmedabad, 430 pages. Barcode 2020050036055   Scan not available.

2655. Prakrita Sarvasva  krishna chandra acharya; Language. Linguistics. Literature, 1968, prakrit text society ahmedabad, 230 pages. Barcode 2020050036056   Scan not available.

2656. Prakriyaasarvasvan' Dvitiiyo Bhaaga  shriinaaraayand-abhat't'apaada; Language. Linguistics. Literature, 1974, keralavishvavidhyaalaya, tiruvanantapurama, 257 pages. Barcode 5010010024892   Scan not available.

2657. Prakriyaasarvasvan' Savyaakhyamu Prathamo Bhaaga  shriinaaraayand-abhat't'apaada; Language. Linguistics. Literature, 1973, keralavishvavidhyaalaya tiruvanantapurama, 215 pages. Barcode 5010010026020   Scan not available.

2658. Prakriyaasavara~svama~  Shriinaaraayand-a Bhat't'aprand-iitan; Language. Linguistics. Literature, 1954, Suraanada Kunajana Pillai, 272 pages. Barcode 2030020016064   Scan not available.

2659. Prakriyasarvasva Taddhita  Narayana Bhatta; Unknown, 1941, University_Of_Madras, 394 pages. Barcode 2020010006880   Scan available.

2660. Prakrta Prakasa  Dr P L Vaidhya; Unknown, 1931, THE ORIENTAL BOOK AGENCIES, 176 pages. Barcode 2020010006881   Scan available.

2661. Prakrutaananda  raghunaatha kavi; Language. Linguistics. Literature, 0, Rajasthan Oriental Research Institute, Jodhpur, 104 pages. Barcode 5010010028271   Scan not available.

2662. Prakrutananda  Pandit. Raghunatha Kavi; Unknown, 999, Rajasthan Oriental Research Institute, Jodhpur, 107 pages. Barcode 5010010001441   Scan not available.

2663. Prakrxtamand-idiipa Prathamao Bhaaga  Appayya Diiqs-ita; Language. Linguistics. Literature, 1953, Da Gavara~nament'a Brancha~ Presa~, 441 pages. Barcode 2030020016514   Scan not available.

2664. Pramaanavaartikabhaashyam Vartikalankaarah  prajnaakaragupta; Language. Linguistics. Literature, 1953, kashiprasad jayaswal research institute, patna, 694 pages. Barcode 5010010026023   Scan not available.

2665. pramaand-a vachana sadgahan' tutiyan'samput'amu  Pandurangacharya Srinivasacharya Waiker; , 1999, DVAITA VEDANTA STUDIES AND RESEARCH FOUNDATION, BANGALORE., 323 pages. Barcode 5010010007372   Scan not available.

2666. pramaand-amajjarii  Jinaviya Muni; Vaishnavism, 1950, Rajasthan Purathatva Mandir,Jaipur, 121 pages. Barcode 5010010005497   Server error, availability unknown.

2667. Pramaand-amajjarii Granthaan'ka 4  Pattabhiram Sastri; The Arts, 1953, Rajastan Puratatva Mandir Jaipur, 126 pages. Barcode 5010010012666   Scan not available.

2668. pramaand-aprameyakalikaa  H.v.shastri; , 1945, BHARATHIYA JANNAPEETA, KASI, 160 pages. Barcode 5010010007373   Scan not available.

2669. Pramaand-avaara~ttikama~ Svaara~thaanumaanaparichchheda  gomi kara~nd-aka; Religion. Theology, 1943, kitaaba Mahala Ilaahaabaada, 652 pages. Barcode 2030020016210   Scan not available.

2670. Pramaand-avaattaka Bhaashhyamuu  Not Available; Language. Linguistics. Literature, 0, Not Available, 690 pages. Barcode 5010010012610   Scan not available.

2671. Pramaand-ayavaada  Not available; Language. Linguistics. Literature, 1964, sanskrit college, calcutta, 140 pages. Barcode 5010010017943   Scan not available.

2672. Pramaand-ayavaada  Not available; Language. Linguistics. Literature, 1964, sanskrit college, calcutta, 146 pages. Barcode 5010010017367   Scan not available.

2673. Prameiyakamalamaarttaand-d'a  maheindrakumaar shaastri; Language. Linguistics. Literature, 1942, Nirnaya Sagar Mudranalaya, Mumbai, 916 pages. Barcode 5010010028233   Scan not available.

2674. Prameya Kaamalamaarthanda Prabhaachandraan  Unknown; Unknown, 999, Unknown, 391 pages. Barcode 5010010010742   Scan not available.

2675. Prameyakamal Martand  Shri Prabha Chandra; Unknown, 1941, Satyabhamabai_Panduranga, 924 pages. Barcode 2020010006889   Scan available.

2676. Prameyakamalamaarataand'aa  Unknown; Language. Linguistics. Literature, 999, Unknown, 390 pages. Barcode 5010010010741   Scan not available.

2677. Prameyaratnaalang-kaara  Shriimadabhinavachaarukiira~tipand-itaachaara~ya; Philosophy. Psychology, 1948, Da Gavara~namen't'a~ Brancha~ Presa~, 262 pages. Barcode 2030020016002   Scan not available.

2678. Prameyaratnalankara  Panditaratnam A.shantiraja Sastri; Unknown, 1948, Printed_By_The_Asst._Supdt._At_The_Govt._Branch_Press, 252 pages. Barcode 2020010006890   Scan available.

2679. Prameykamlamartand Vol Ii  P. Mahendrakumar Shastriyna; Unknown, 1941, Nirnaysagarmudranalaykrut_Tatrev_Mudrapvitva_Prakashit, 922 pages. Barcode 2020010006891   Scan available.

2680. prand-avavaadan' pradhamabhaagan  Pandit. K. T. Sreenivasachariar; Philosophy, 1915, The Bramhavadin Press Madras, 668 pages. Barcode 5010010005499   Server error, availability unknown.

2681. prapajjahrxdayan'  ta. gand-apatishaastriind-aa; Literature, 1915, Rajakeeya Press, 134 pages. Barcode 5010010092001   Scan available.

2682. Prapan'chasaara Saara San'graha Bhaaga 2  girvanendra saraswathi; Religion. Theology, 1963, t. m. s. s. m. library, tanjavur, 529 pages. Barcode 5010010024896   Scan not available.

2683. Prapancha Sara Tantra Of Sankaracharya  Atalananda Sarasvati; Tantras, 1981, Motilal_Banarasidass, 722 pages. Barcode 5010010001452   Scan not available.

2684. Prapannaparijatam  sri vatsya vardacharya; Language. Linguistics. Literature, 1954, T.T.D Tirupati, 82 pages. Barcode 2020050058030   Scan not available.

2685. prapatrapaarijaatan  Sudara Chary. T.k.v.n; Literature, 1954, T.T.D Tirupati, 73 pages. Barcode 5010010007375   Scan not available.

2686. Prasaada Mand-d'anama~  Sutradhaaramand-d'ana; The Arts, 1947, Da Shrii Dura~gaa Presa~, 77 pages. Barcode 2030020016427   Scan not available.

2687. Prasadamandanam  Sutra Dharamandana; Unknown, 1947, Sri_Maharaja_Harisinghji_Bahadur, 70 pages. Barcode 2020010006915   Scan available.

2688. Prasang-kavign-aanaatsiddhamu  Not available; Language. Linguistics. Literature, 0, Not available, 121 pages. Barcode 5010010018008   Scan not available.

2689. Prasannaraaghavaa  Jayadeva; Religion. Theology, 1894, Shiralkar And Company, Poona, 350 pages. Barcode 5010010009645   Scan not available.

2690. prasannaraaghavamu sat'iikamu  Jayadeva; Tantras, 1984, Shivarama Raoji Khopakar Bombay, 426 pages. Barcode 5010010001453   Server error, availability unknown.

2691. Prasannaraaghavamuu  vasudev laxman shastri pansikar; LANGUAGE. LINGUISTICS. LITERATURE, 1922, Pandurang Jawaji ,The Nirnaya Sagar Press,Bombay, 134 pages. Barcode 5010010078759   Scan available.

2692. Prashanamka Choodamani  Pandit sri seetaramanga Jotishaclarya; Religion. Theology, 999, Chowieamsiler vidyabhavan varanasi, 20 pages. Barcode 2020050017233   Scan available.

2693. Prashanj-aanamu  subramand-ya saastri; Language. Linguistics. Literature, 1949, Aruna Press, Banglore, 123 pages. Barcode 5010010024907   Scan not available.

2694. Prashnachand-d'oshvara  pandit vishnu dutt; General, 2005, kemaraj srikrishnadas prkashan, 88 pages. Barcode 2020050017235   Scan not available.

2695. Prashnashiromand-i Bhaavaarthabodhiniibhaashhaat'iikaasahita  pan'd'itarudramund-i; Language. Linguistics. Literature, 1979, laqs-miiveng-kad'eshvara mudrand-aalaya, mun'bayii, 194 pages. Barcode 5010010025712   Scan not available.

2696. Prashnootararatnamaalikaa  san'kara bhagavatpaada; Language. Linguistics. Literature, 1992, t'i. t'i devastaanamu, 48 pages. Barcode 5010010012609   Scan not available.

2697. Prashnopanishhata~ Grantha 8  Aanandagiri; Religion. Theology, 1932, Aanandaashramamudrand-aalaye, 134 pages. Barcode 2030020016186   Scan not available.

2698. prashnopanishhdbhaashhyamuu  shriimachchhan'kara bhagavatpuujyapaadai; Literature, 1886, Not available, 34 pages. Barcode 5010010092139   Scan available.

2699. prashnopanishht  chin'taamand-a gan'gaadhara bhaanu; Literature, 1912, Induprakash Press , Mumbai, 265 pages. Barcode 5010010092104   Scan available.

2700. Prashnotaramaalaa  krishnamachari; LANGUAGE. LINGUISTICS. LITERATURE, 1916, madramaraad'alaraajakiiyamudraalayapratayaveichakeirraa mudraapitaa, 72 pages. Barcode 5010010078316   Scan available.

2701. Prashropanishhatan't'iikaasan'valita San'karabhaashhyasametaa  Anandagiri; Language. Linguistics. Literature, 1896, Hari Narayana Apte, 106 pages. Barcode 5010010030036   Scan not available.

2702. Prasnamarga  Punnasseri Nambi Neelakndha Sarma; Religion. Theology, 1926, R.Subrahamanya Radhyar, 346 pages. Barcode 2020050017201   Scan available.

2703. Prasnopanisad Bhasya I I- Edition  K.c.varadhachari; Unknown, 1978, T.T.D Tirupati, 186 pages. Barcode 2020010006919   Scan available.

2704. Prasnopanishad Bhasya  Tallapally Muralidhara Gowd; Unknown, 1951, T.T.D Tirupati, 152 pages. Barcode 2020010013002   Server error, availability unknown.

2705. Prasnopanishhatuu  hari naaraayand-a; RELIGION. THEOLOGY, 1896, Not Available, 106 pages. Barcode 5010010042358   Scan not available.

2706. Prasthaanaratnaakara  ratna gopala bhat't'a; LANGUAGE. LINGUISTICS. LITERATURE, 0, Chowkhamba Sanskrit Series Office , Benares, 223 pages. Barcode 5010010042549   Scan not available.

2707. Prataaparudiiyamuu  a panchapagesa iyer; LANGUAGE. LINGUISTICS. LITERATURE, 1914, The Sri Balamanorama Press , Madras, 351 pages. Barcode 5010010078723   Scan available.

2708. Prataaparudrayashobhuushhand-an' Ratnaapand-aaravyat'iikayaa  shriividhyaanaatha; Language. Linguistics. Literature, 1909, mumbaapuuriisyaraajakiiyagranthamaalaadhikaarind-aa, 858 pages. Barcode 5010010028246   Scan not available.

2709. Prataaparudriiyamu Alan'kaarashaastramu Vyaakhyaaya  vidhyaanaatha; Language. Linguistics. Literature, 1950, balamanorama press, madras, 360 pages. Barcode 5010010028247   Scan not available.

2710. Prataaparudriiyamuu  s chandrasekhara sastrigal; PHILOSOPHY. PSYCHOLOGY, 1914, s chandrasekhara sastrigal , triplicane, madras, 354 pages. Barcode 5010010078204   Scan available.

2711. Prataha Smranmala  -; Unknown, 1955, M.d.gadgill, 94 pages. Barcode 2020010006920   Scan available.

2712. prathamollaasa  Not available; Literature, 1895, Not available, 123 pages. Barcode 5010010092120   Scan available.

2713. pratidvarasutramu  Bellokoth Ramachandra Sharma; Religion. Theology, 1973, DR Mandana Mishra Kendriya Sanskrit Vidyapeetha, Tirupati, 342 pages. Barcode 5010010005504   Server error, availability unknown.

2714. pratijnj-aayaugandharaayand-an'  ta. gand-apatishaastrind-aa; Literature, 1912, Rajakeeya Press, 110 pages. Barcode 5010010091983   Scan available.

2715. Pratijnj-ayaugan'dharaayand-amu  si ar deivadhar; Language. Linguistics. Literature, 1962, Oriental Book Agency, 138 pages. Barcode 5010010012552   Scan not available.

2716. Pratima Natakam  Sri Ramachandra Mishra; Unknown, 1999, CHOUKHAMBA SANSKRIT SERIES OFFICE,VARANASI, 239 pages. Barcode 2020010013009   Server error, availability unknown.

2717. Pratimaa Mana Laqs-and-ama~  Bosa Phanin'draa Naatha; Religion. Theology, 1929, Moti Laala Banaarasii Daasa, 98 pages. Barcode 2030020016080   Scan not available.

2718. pratimaanaat'akam  ta. gand-apatishaastrind-aa; Literature, 1915, Rajakeeya Press, 212 pages. Barcode 5010010092051   Scan not available.

2719. Pratistaa Sangrahn  Pandit Ramlal; Unknown, 1942, Hindustan Sarkar, Mumbai, 646 pages. Barcode 5010010010740   Scan not available.

2720. Pratyabhijnahrdayam  emil baer ed; Language. Linguistics. Literature, 1938, adyar library madras, 248 pages. Barcode 2020050058001   Scan not available.

2721. pratyakatvachintaamand-i Vol 2  Sri Sadanandha Vidyadhar; Philosophy. Psychology, 0, Praaschatya Grandhamala Karyalaya, Kaasi, 454 pages. Barcode 5010010026450   Scan not available.

2722. Pratyakruttatvachintamani Vol I  Sri Sadanand Vidvadwirichith; Unknown, 1688, Achyut_Granthamala_Karyalay, 370 pages. Barcode 2020010006934   Scan available.

2723. pratyaqs-attvachintaamand-ivimashain  N S Ramanuja Tatacharya; Linguistics Literature, 1992, Rashtriya Sanskrit Vidhyapeetha Tirupati, 388 pages. Barcode 5010010005508   Server error, availability unknown.

2724. Praud'hamanooramaakhand-d'anagranthasya  not available; Language. Linguistics. Literature, 0, The Vavilla Press, Madras, 140 pages. Barcode 5010010028253   Scan not available.

2725. Pravachanasaara  shriikund'akund'aachaarya; Language. Linguistics. Literature, 1935, sheethaamanilal revashankar jhaveri bombay, 596 pages. Barcode 5010010017776   Scan not available.

2726. Prayaaga Mahaatyamu  Unknown; Unknown, 999, Unknown, 319 pages. Barcode 5010010010739   Scan not available.

2727. prayaagamahatyam  Not available; Literature, 1869, Not available, 50 pages. Barcode 5010010091942   Scan available.

2728. Prayodhya Kavyam  Sri P.gangaprasad; Unknown, 999, Kala_Press, 246 pages. Barcode 2020010006936   Scan available.

2729. prayogaratnamaalaa  K.ramanuja Tatacharya; Religion, 1991, Sarasvati Mahal Library Thanjavur, 443 pages. Barcode 5010010001459   Server error, availability unknown.

2730. Preimavijaya  sundareisha sharma; Language. Linguistics. Literature, 1943, The General Stores , Tanjore ., 100 pages. Barcode 5010010012608   Scan not available.

2731. Prem Pathanam  Sri Krishnaiah Panth Sastriye; Unknown, 1989, Shachruya_Granthmala_Karyalaya, 242 pages. Barcode 2020010006943   Scan available.

2732. Premarasaayana  visvanaatha pandit; Language. Linguistics. Literature, 1928, chaukhambhaa san'skrxta san'sthaana vaaraand-asii, 109 pages. Barcode 5010010025716   Scan not available.

2733. Premarasayana  Visvanatha Pandita; Unknown, 1928, Jaikrishnadas_Haridas_Gupta, 112 pages. Barcode 2020010006940   Scan available.

2734. Priitilataakusumopetaa Vrxttamaalaa  Shaacharya Shidarajamaloki; Language. Linguistics. Literature, 999, Not Available, 64 pages. Barcode 5010010029772   Scan not available.

2735. Proceeding And Transactions Of The Fifth Indian Oriental Conforence Vol I  G D Thukral; Unknown, 1930, THE MERCANTILE PRESS, 828 pages. Barcode 2020010006962   Scan available.

2736. Proceedings And Transactions Of The All India Oriental Conference  a s altekar; Unknown, 1947, benares hindu university, 936 pages. Barcode 2020010006963   Scan available.

2737. Proceedings And Transactions Of The First Oriental Conference Poona Vol 1  -; Unknown, 1920, bhandarkar ooriental research insitute, 310 pages. Barcode 2020010006964   Scan available.

2738. Proceedings And Transactions Of The First Oriental Confirence Poona  -; Unknown, 1922, bhandarkar oriental research insitute, 490 pages. Barcode 2020010006965   Scan available.

2739. prodamanoramaa  ; Sanskrit Grammer, 999, , 134 pages. Barcode 5010010007384   Scan not available.

2740. Punjab Industries, 1911-1917  A.c. Badenoch; Sanskrit Grammer, 1917, PRINTED BY THE SUPRERINTENDENT, GOVERNMENT PRINTING (PUNJAB), 124 pages. Barcode 5010010007386   Scan not available.

2741. Puraand-akaavya Stootra Sudhaa  e pi karmaarkara; Language. Linguistics. Literature, 1955, thaal'akavaad'ii belgaamuu, 320 pages. Barcode 5010010017777   Scan not available.

2742. puraand-amu  No; Unknown, 1959, All India Kashiraj Trust, Ramnagar, 17 pages. Barcode 5010010005530   Server error, availability unknown.

2743. Puraand-aparyaloochanamu  shriikushhnd-amand-itripaat'hii; Language. Linguistics. Literature, 1976, Chokamba Samskruta Prakashan, Varanasi, 432 pages. Barcode 5010010028260   Scan not available.

2744. Puraand-aparyaloochanamu Bhaag Ii  shriikushhnd-amand-itripaat'hii; Language. Linguistics. Literature, 1975, Chowkamba Samskruta Prakashan, Varanasi, 346 pages. Barcode 5010010028261   Scan not available.

2745. Purajjanacharita Naat'akamuu  krxshhnd-adatta maithila; Language. Linguistics. Literature, 1961, Vidarbha Samsodhana Mandala , Nagpur ., 174 pages. Barcode 5010010012551   Scan not available.

2746. Purana Panchalaksana  Dr. Suryakanth Shastri; Unknown, 1979, Chowkhamba_Sanskrith_Series_Office, 626 pages. Barcode 2020010006981   Scan available.

2747. Purana Vishya Samnukramayaka  Yashpal Tandon's; Unknown, 1952, Vishveshwaranand_Institute_Publications, 82 pages. Barcode 2020010006984   Scan available.

2748. Puranika~ En'thalojy Puraand-a Kaavya Stotra Sudha  Kara~mara~kara~ Epi; Religion. Theology, 1935, Miiraa Pablishhinga~ Hausa~, 330 pages. Barcode 2030020016400   Scan not available.

2749. Purascaryarnava  Late. Pt. Muralidhar jha; Unknown, 1985, Chaukhamba Sanskrit Pratishthan, 1323 pages. Barcode 2020010006987   Scan available.

2750. Purchryarnav  pratap singh; Language. Linguistics. Literature, 1941, -, 626 pages. Barcode 2020050036040   Scan not available.

2751. Purusharth Chintamani  Vasudev Sharma; Unknown, 1927, -, 480 pages. Barcode 2020010006991   Scan available.

2752. Purushhaarthachintaamand-i  hari naaraayand-a; Language. Linguistics. Literature, 1922, Ananda Sama Mudranalaya, Poona, 608 pages. Barcode 5010010024914   Scan not available.

2753. Purushhaarthachintaamand-isthavishhayaanukrama  Not available; Language. Linguistics. Literature, 0, Not available, 608 pages. Barcode 5010010026042   Scan not available.

2754. Purushhaarthasudhaanidhi  sayaana kaarya; Language. Linguistics. Literature, 1955, Law Journal Press, Madras, 674 pages. Barcode 5010010028262   Scan not available.

2755. purushhaathaichin'taamand-o  Vasudeva Sarma; Sanskrit - Religion, 1917, Niryana Sagar Press, Bombay, 488 pages. Barcode 5010010007403   Scan not available.

2756. purushhaathaisudhaanidhin  T.chandrasekharan; Unknown, 1955, Madras Law Journal Press Mylapore, 679 pages. Barcode 5010010001485   Server error, availability unknown.

2757. purushhasitramu  Hanumacharya; Unknown, 1956, Dhananya Warkhedkar Bangalore, 35 pages. Barcode 5010010001487   Server error, availability unknown.

2758. Purushparthchintamani  Sri Madramkrishnabhattsunuvishnubhatt; Unknown, 999, Panduranga Jawaji, 492 pages. Barcode 2020010006992   Scan available.

2759. Purva Kalaamrutamu  Lakshminarasimha; Religion. Theology, 1985, Lakshminarasimha, 286 pages. Barcode 2020050017196   Scan available.

2760. Purva Mimamsa  Yagna Ramulu; Unknown, 1993, T.T.D Tirupati, 176 pages. Barcode 2020010006994   Scan available.

2761. Purva Mimansa Darsana  Mahadeva Sastry. A; Sanskrit Religion, 1908, The Government Of Mysore, Mysore, 369 pages. Barcode 5010010007404   Scan not available.

2762. Purvakhandatmika Bhaktiyogaparisha  A. Bharatwaj; Unknown, 1999, Isavyasa Pratishtana, Bangalore, 611 pages. Barcode 5010010001489   Scan not available.

2763. Purvamimamsa - Darsana with Khandadeva s Bhatta Dipika Vol III  A. Madavadeva Shastry Editior; LANGUAGE. LINGUISTICS. LITERATURE, 1914, Govt of Mysore, 155 pages. Barcode 2020050088369   Scan available.

2764. puurnd-aprajnj-aadarshanam  Not available; Literature, 1885, Not available, 182 pages. Barcode 5010010091956   Scan available.

2765. puurvamiimaan'saadarshanam  shriigvand-d'adeva; Literature, 1908, The Government Press , Mysore, 371 pages. Barcode 5010010092079   Scan available.

2766. Puurvamiimaan'saadarshanamu Dvitiiyasamput'amu  shriikhand-d'adeva; Religion. Theology, 1911, government branch press, mysore, 392 pages. Barcode 5010010024918   Scan not available.

2767. Puurvamiimaan'saadarshanamu Trxtiiyasamput'amu  shrikhand-d'adeva; Language. Linguistics. Literature, 1914, the government branch press mysore, 324 pages. Barcode 5010010017779   Scan not available.

2768. Puurvamiimaan'saadarshanamuu Chaturthasamput'amuu  shriikhand-d'adeva; Language. Linguistics. Literature, 1916, the government branch press mysore, 428 pages. Barcode 5010010017778   Scan not available.

2769. Puurvamimaan'saa Darshanamu Vol.i  e mahaadeiva saastri; Language. Linguistics. Literature, 1908, Government Branch Press,Mysore, 372 pages. Barcode 5010010025036   Scan not available.

2770. Puuthviiraajavijayamhaakaavyamuu  b k belvarkar; LANGUAGE. LINGUISTICS. LITERATURE, 1914, asiatic Society no 1, park street calcutta, 262 pages. Barcode 5010010080059   Scan available.

Return to the top

Q


2771. qs-airatarad'agnd-ii  Kshira Swami; Sanskrit Grammer, 1955, Manti Sri Ramlal Kapoor Trust Amritsar, 417 pages. Barcode 5010010007132   Scan not available.

2772. qs-i bhagavadraamaanujavirachite qs-ishaarirakamiimaan'shaabhaashhye Part 1  Sri Lakshmi Narasimhakumar; Philosophy. Psychology, 1936, Ananda Ashrama, 434 pages. Barcode 5010010026449   Scan not available.

2773. qs-i bhuvanadevaachaayevirachitaa aparaajitaprachha  Popatbhai Ambashankar Mankad; Religion. Theology, 1950, Oriental Institute, Baroda, 791 pages. Barcode 5010010026448   Scan not available.

2774. qs-ibhaashhyamuu chatushuutribhaaga  Maha Mahopadya Sudarshana Vyasabhatta; Philosophy. Psychology, 1916, T. Srinivasa Sarma, 290 pages. Barcode 5010010026447   Scan not available.

2775. qs-iimada naarand-yamuniprand-iitaa panchadashii  Narayana Ram Acharya; Philosophy. Psychology, 1949, Nirnaya Sagar Publications, 580 pages. Barcode 5010010026446   Scan not available.

2776. Qs-iira Ratagd'ind-ii  Miimaan'saka Yudhishht'hira; Language. Linguistics. Literature, 1950, Raamalaala Kapuura T'ara~st'a, 451 pages. Barcode 2030020016100   Scan not available.

2777. qs-imaddhekhaanasekaasyapajaanakaand-d'a  Parthasarathi Bhattachar; Philosophy. Psychology, 1948, S.V.U. Oriental Research Institute Tirupati, 214 pages. Barcode 5010010026445   Scan not available.

2778. qs-imadraamaanujaachaayeprand-iitan' qs-ibhaashhyamuu Part Ii Introduction And Notes  Vasudev Shastri Abhyankar; Philosophy. Psychology, 1916, Bombay Sanskrit and Prakrit Series, 368 pages. Barcode 5010010026444   Scan not available.

2779. qs-imatsanatsujaatiiyamuu  B. Gururaja Rao; Religion. Theology, 1940, Bangalore Sriman Madhva Sabha, 144 pages. Barcode 5010010026443   Scan not available.

2780. qs-inad'apaadavirachitaa seikodheshat'iikaa  Mario E. Carelli; Religion. Theology, 1941, Oriental Institute, Poona, 148 pages. Barcode 5010010026442   Scan not available.

2781. qs-ivanamaalivirachitaabrahaasuutrasiddhaantamuktaavali  Not Available; Religion. Theology, 1942, Vinayaka Ganesh Apte, 252 pages. Barcode 5010010026441   Scan not available.

2782. qs-utiratnaprakaasha qs-itimateudyota  Tryambaka Sastri; Philosophy. Psychology, 1910, Sri Kamakshi Amma, Mayavaram, 102 pages. Barcode 5010010026440   Scan not available.

Return to the top

R


2783. Raadhaaparind-aayamuu Mahaakaavyamuu  Not Available; LANGUAGE. LINGUISTICS. LITERATURE, 1931, Vijaya Mudranalayam , Chennai, 304 pages. Barcode 5010010042487   Scan not available.

2784. Raagaratnaakara  Not Available; Language. Linguistics. Literature, 0, Not Available, 706 pages. Barcode 5010010012607   Scan not available.

2785. Raagaratnaakaraa  khemaraaja shriikrxshhnd-adaasane; Language. Linguistics. Literature, 1966, shriiven'kat'eshvaraa st'iimu yantraalaya, 702 pages. Barcode 5010010012606   Scan not available.

2786. Raagatattvaviboodha  shriinivaasa; Language. Linguistics. Literature, 0, Oriental Series , Baroda ., 84 pages. Barcode 5010010012605   Scan not available.

2787. Raaghavanaishhadhiiyamu Savisheshhavimarshinii Prakaashasan'skrxta Hindiivyaakhyopetamu  shriiharadattasuuri; Language. Linguistics. Literature, 1969, chaukhamba sanskrit series office, benares, 95 pages. Barcode 5010010026071   Scan not available.

2788. Raaghavanaishhadhiyamu  shriiharadattasuri; Language. Linguistics. Literature, 1896, Tukaram Javaji,Bombay, 74 pages. Barcode 5010010032898   Scan not available.

2789. Raaghavapaand-d'aviyamu  shriikaviraaja; Language. Linguistics. Literature, 1897, Tukaram Javaji,Bombay, 216 pages. Barcode 5010010032893   Scan not available.

2790. Raajadhamaikaand-d'amu  K.v. Rangaswami; Language. Linguistics. Literature, 1944, Oriental Instirute, Baroda, 117 pages. Barcode 5010010024658   Scan not available.

2791. Raajadhamaikaand-d'amu Ekaadasho Bhaagan  K.v.rangaswami; Language. Linguistics. Literature, 1943, Oriental Instirute, Baroda, 410 pages. Barcode 5010010024639   Scan not available.

2792. Raajatarangind-i  durgaprasada; Language. Linguistics. Literature, 1892, Tukaram Javaji,Bombay, 393 pages. Barcode 5010010032881   Scan not available.

2793. Raajatarangind-i Ii  durgaprasada; Language. Linguistics. Literature, 1894, Tukaram Javaji,Bombay, 308 pages. Barcode 5010010032888   Scan not available.

2794. Raajatarangind-i Iii  durgaprasada; Language. Linguistics. Literature, 1896, Tukaram Javaji,Bombay, 410 pages. Barcode 5010010032877   Scan not available.

2795. Raama Charchaa  premachanda; Language. Linguistics. Literature, 1948, daqs-ind-a bhaarata hindustaanii prachaara sabhaa madraas, 168 pages. Barcode 5010010026730   Scan not available.

2796. Raamaayana Of Vaalmiki Bala Kanda  Bhagavad Datta; Unknown, 1931, The_D_A_V_College, 536 pages. Barcode 2020010007002   Scan available.

2797. Raamaayand-a  khemaraaja shriikrxshhnd-adaasa; Language. Linguistics. Literature, 0, shriivenkat'eshvara st'iimu presa, 920 pages. Barcode 5010010012600   Scan not available.

2798. Raamaayand-a Baalakaand-ad'a  tulasiidaasa; Language. Linguistics. Literature, 1886, Not available, 553 pages. Barcode 5010010012486   Scan not available.

2799. Raamaayand-a Sampuurnd-a Qs-epaka  khemaraja shriikrxshnd-adaasa; Language. Linguistics. Literature, 1827, shriiveng-kat'eshvaraa st'iimu yantraalaya, 753 pages. Barcode 5010010012410   Scan not available.

2800. raamaayand-am sundarakaand-d'ama  kaashiinaatha paand-d'uran'ga paraba; Literature, 1902, Nirnayasagar Press , Mumbai, 556 pages. Barcode 5010010092122   Scan available.

2801. Raamaayand-amajjari  shriikshemendra; Language. Linguistics. Literature, 1903, Tukaram Javaji,Bombay, 519 pages. Barcode 5010010032871   Scan not available.

2802. raamaayand-ama~  Sri Vasudeva Laxman Sastri Paniskar; LANGUAGE. LINGUISTICS. LITERATURE, 1930, Pandurang Javaji, 1170 pages. Barcode 5010010032506   Server error, availability unknown.

2803. raamaayand-ama~ arand-yakaand-d'ama~  Sri Shrinivas Katti Mudholkar; LANGUAGE. LINGUISTICS. LITERATURE, 1914, The Gujarathi Printing Press, 348 pages. Barcode 5010010033800   Server error, availability unknown.

2804. raamaayand-ama~ Part II  Sri Valmiki; LANGUAGE. LINGUISTICS. LITERATURE, 1929, Sri Ramaswami Sastrulu And Sons, 1077 pages. Barcode 5010010032185   Server error, availability unknown.

2805. Raamaayand-ama~ Prathama Khand-d'a  Vaalmiiki; Social Sciences, 1875, Shrii sa raa saradesaaii samara~thabhaaratamudrand-aalaye, 163 pages. Barcode 2030020016217   Scan not available.

2806. Raamaayand-amu Ayoodhyaakaand-d'amuu  shriimayaakavishrivaalmiiki; Language. Linguistics. Literature, 1923, lalji daass manager hindi press laahore, 316 pages. Barcode 5010010017780   Scan not available.

2807. Raamaayand-amu Baalakaand-d'amuu  shriimayaakavishrivaalmiiki; Language. Linguistics. Literature, 1867, government central book depot bombay, 224 pages. Barcode 5010010017781   Scan not available.

2808. Raamaayand-amu Kishhkindhaakaand-d'amu  shriimadvalmiiki mahaamuni; Religion. Theology, 1915, gujaraatii mudrand-aalayamu mumbayyaa, 318 pages. Barcode 5010010018069   Scan not available.

2809. Raamaayand-amuu Arand-yakaand-d'amuu  shriimadvalmiikimahaamuni; Language. Linguistics. Literature, 0, Not available, 342 pages. Barcode 5010010018065   Scan not available.

2810. Raamaayand-amuu Baalakaand-ad'amuu  shriimadvalmiikimahaamuni; Language. Linguistics. Literature, 1912, gujaraatii mudrand-aalayamuu, mumbayyaa, 426 pages. Barcode 5010010018066   Scan not available.

2811. Raamaayand-amuu Baalakaand-d'amuu  kat't'ii shriinivaasa; RELIGION. THEOLOGY, 1922, The Gujarati Printing Press , Bombay, 424 pages. Barcode 5010010078317   Scan available.

2812. Raamaayand-amuu Kishhkindhaakaand-d'amuu  kat't'ii shriinivaasa; RELIGION. THEOLOGY, 1915, The Gujarati Printing Press , Bombay, 328 pages. Barcode 5010010078352   Scan available.

2813. Raamaayand-amuu Sundarakaand-d'amuu  shriimadvalmiikimahaamuni; Language. Linguistics. Literature, 1916, gujaraatii mudrand-aalayamuu, mumbayyaa, 354 pages. Barcode 5010010018067   Scan not available.

2814. Raamaayand-amuu Sundarakaand-d'amuu  kat't'ii shriinivaasa; RELIGION. THEOLOGY, 1916, The Gujarati Printing Press , Bombay, 350 pages. Barcode 5010010078321   Scan available.

2815. Raamaayand-amuu Uttarakaand-d'amuu  shriimadvalmiikimahaamuni; Language. Linguistics. Literature, 1920, gujaraatii mudrand-aalayamuu, mumbayyaa, 362 pages. Barcode 5010010018068   Scan not available.

2816. Raamaayand-amuu Uttarakaand-d'amuu  kat't'ii shriinivaasa; RELIGION. THEOLOGY, 1920, The Gujarati Printing Press , Bombay, 363 pages. Barcode 5010010078295   Scan available.

2817. Raamaayand-asan'qs-eipasagrarasasvaada  Not Availble; Language. Linguistics. Literature, 0, Not Availble, 124 pages. Barcode 5010010012543   Scan not available.

2818. raamajoshiikrx laavand-yaa  shan'kara tukaaraama shaaligraama; Literature, 1908, Chitrashala Press , Poone, 144 pages. Barcode 5010010092036   Scan available.

2819. Raamakarnd-arasaayanamu Prathamo Nishhyanda  Not available; Language. Linguistics. Literature, 0, Not available, 74 pages. Barcode 5010010026074   Scan not available.

2820. Raamakathaa  vaasudeva; Language. Linguistics. Literature, 1929, shrii baalamanoorama presa madraasu, 66 pages. Barcode 5010010017782   Scan not available.

2821. Raamasandesha Padaarthaprakaashaakhyayaa T'iikaayaa Sameta  shriiraajaraajeshvarapuujyacharand-a; Language. Linguistics. Literature, 1917, ud'upi shriikrxshhnd-amudraayantre, 140 pages. Barcode 5010010024929   Scan not available.

2822. Raamasvayan'varsya Vishhayaanukramand-ikaapraarambha  mahaaraaja shriiraghuraajasen'hajii deiva; Language. Linguistics. Literature, 1822, Not available, 1006 pages. Barcode 5010010012542   Scan not available.

2823. Raasabihaarii Basuun'che Kraan'tijiivana  Haradaasa Baalashaastrii Saahityaachaara~ya; Geography. Biography. History, 1952, Surasagran'thamaalaa Pan'd'arapuua~, 118 pages. Barcode 2030020016387   Scan not available.

2824. Raashht'a~ra Giitaanj-jali  Da~vivedii Kapiladeva; Language. Linguistics. Literature, 1945, Shiilaa Print'ara~sa~, 226 pages. Barcode 2030020016511   Scan not available.

2825. Raavand-aarjuniyamu  shriibhat't'abhima; Language. Linguistics. Literature, 1900, Tukaram Javaji,Bombay, 218 pages. Barcode 5010010032864   Scan not available.

2826. Ragatarangini  Ranjit Sitaram Pandit; Unknown, 1935, SAHITYA AKADEMY, 826 pages. Barcode 2020010007016   Scan available.

2827. Ragavibodha  S.subrahmanya Sastri; History, 1945, ADYAR LIBRARY, 308 pages. Barcode 5010010007408   Scan not available.

2828. Raghava Naishadhiya  Pandit Sivadatta; Unknown, 1926, Andurang_Jawaji, 82 pages. Barcode 2020010007020   Scan available.

2829. Raghunaathavilaasamu Naama Naat'akamu  yagn-anaaraayand-adiiqs-ita; Language. Linguistics. Literature, 1958, tanj-japurii sarasvatiimahala nirvaahikasamityaa, 174 pages. Barcode 5010010028256   Scan not available.

2830. raghuvamsa  gopala raghunatha nandargikara; Religion, 1885, Arya Bhusana Press, Poona, 576 pages. Barcode 5010010087190   Scan not available.

2831. Raghuvamsam  Saradaranjanray Vidyavinode; Unknown, 999, Kumudranan_Ray, 302 pages. Barcode 2020010007027   Scan available.

2832. Raghuvamsam (Canto Vi)  Saradaranjay Ray; Unknown, 1940, Kumudranjan_Ray, 348 pages. Barcode 2020010007025   Scan available.

2833. Raghuvamsam Canto V  G.a.shastry; Unknown, 999, Shastry_and_Sons, 154 pages. Barcode 2020010007026   Scan available.

2834. Raghuvamsham  Dr.shrikrishnamani Tripathi; Unknown, 1983, Chaukhamba_Surbharati_Prakashan, 730 pages. Barcode 2020010007029   Scan available.

2835. Raghuvamshamahakavyam  Sri P Ramachandraghna Vyakaranacharyah; Unknown, 2002, Krushnadas_Akadami_Varanasi, 795 pages. Barcode 2020010013076   Server error, availability unknown.

2836. Raghuvan'shaavimarshaa  ra . krxshhnd-amaachaaryaind-a; LANGUAGE. LINGUISTICS. LITERATURE, 1908, Sri Vani Vilas Press , Srirangam, 174 pages. Barcode 5010010078342   Scan available.

2837. Raghuvan'shamahaakaavyama~  Mishra Brahmashan'kara; Philosophy. Psychology, 1950, Chaukhambaa San'skrxta Siiriza Aafisa, 605 pages. Barcode 2030020016046   Scan not available.

2838. Raghuvan'shamuu  Not Available; Language. Linguistics. Literature, 0, Not Available, 576 pages. Barcode 5010010012686   Scan not available.

2839. Raghuvan'shavimarsha  ra. krxshhnd-amaachaaryend-aa; Language. Linguistics. Literature, 1908, shriivaand-iivilaasamudraayantraalaye, 168 pages. Barcode 5010010012541   Scan not available.

2840. Raghuvansh  kalidasa; Language. Linguistics. Literature, 1944, -, 360 pages. Barcode 2020050057969   Scan not available.

2841. Raghuviracharata  T.ganapati Sastri; Unknown, 1917, Printed_By_The_Superintendent_Government_Press, 168 pages. Barcode 2020010007031   Scan available.

2842. Raja Tarangini  Kalhana; Unknown, 1985, Chaukamba_Sanskrit_Pratishthan, 588 pages. Barcode 2020010007057   Scan available.

2843. Ram Rasayan Ayodhyakand  Jagannath Prasad Kayath; Literature, 1895, Bhartiya Jivan Press, kashi, 234 pages. Barcode 5990010044061   Server error, availability unknown.

2844. Ram Swayamvaram  -; Unknown, 999, -, 706 pages. Barcode 2020010007111   Scan available.

2845. Ramalashiktha Jyothish  Unknown; Unknown, 999, Unknown, 193 pages. Barcode 5010010010738   Scan not available.

2846. Ramas Later History Vol X X I  Shripad Krishna Belvalkar; Unknown, 1915, HARVARD UNIVERSITY PRESS, 192 pages. Barcode 2020010007085   Scan available.

2847. Ramayan Valmikiye Aadikand  -; Unknown, 999, -, 454 pages. Barcode 2020010007108   Scan available.

2848. Ramayana  Rajagopalachari.c; Religion, 1965, Bharatiya_Vidya_Bhavan_Bombay, 681 pages. Barcode 5010010005558   Server error, availability unknown.

2849. Ramayana Of Valmiki India S National Epic  Raghu Vira; Unknown, 1938, The_International_Acedemy_Of_Indian_Culture, 112 pages. Barcode 2020010007092   Scan available.

2850. Ramayana Of Valmiki The Aranya Kanda  Bhagavad Datta; Unknown, 1935, The_D_A_V_College, 481 pages. Barcode 2020010007093   Scan available.

2851. Ramayana Of Valmiki Vol I Balakanda  Satkari Mukhopadhyaya; Unknown, 1983, Oriental_Booksellers_And_Publishers, 460 pages. Barcode 2020010007094   Scan available.

2852. Ramayana Of Valmiki Vol Ii Ayodyakanda  Satkari Mukhopadhyaya; Unknown, 1983, Oriental_Booksellers_And_Publishers, 638 pages. Barcode 2020010007095   Scan available.

2853. Ramayana Of Valmiki Vol Iii Aranyakanda  Satkari Mukhopadhyaya; Unknown, 1983, Oriental_Booksellers_And_Publishers, 350 pages. Barcode 2020010007096   Scan available.

2854. Ramayana Of Valmiki Vol Iv Kishkindhakanda  Satkari Mukhopadhyaya; Unknown, 1983, Oriental_Booksellers_And_Publishers, 317 pages. Barcode 2020010007097   Scan available.

2855. Ramayana Of Valmiki Vol V Sundarakanda  Satkari Mukhopadhyaya; Unknown, 1983, Oriental_Booksellers_And_Publishers, 354 pages. Barcode 2020010007101   Scan available.

2856. Ramayana Of Valmiki Vol Vii Uttarakanda  Satkari Mukhopadhyaya; Unknown, 1983, Oriental_Booksellers_And_Publishers, 369 pages. Barcode 2020010007099   Scan available.

2857. Ramayana Of Valmiki Vol Vii Yuddhakanda  Satkari Mukhopadhyaya; Unknown, 1983, Oriental_Booksellers_And_Publishers, 700 pages. Barcode 2020010007100   Scan available.

2858. Ramayana Of Valmiki Vol Viii Index Of Verses  Satkari Mukhopadhyaya; Unknown, 1983, Oriental_Booksellers_And_Publishers, 330 pages. Barcode 2020010007098   Scan available.

2859. Ramayana Of Valmiki Yudda Kanda  Vishva Bhndhu Shastri; Unknown, 1944, The_D_A_V_College, 612 pages. Barcode 2020010007102   Scan available.

2860. Ramayana Ramabirama  Unknown; Unknown, 999, Unknown, 845 pages. Barcode 5010010010737   Scan not available.

2861. Ramayana Vol 3  Di Valmici; Unknown, 999, Dalla_Stamperia_Nazionale, 523 pages. Barcode 2020010007106   Scan available.

2862. Ramayana With Three Commentry Tika  Unknown; Unknown, 1902, Unknown, 1260 pages. Barcode 5010010010736   Scan not available.

2863. Rangaayana  Peeyush Darya; Religion, 1934, Bharatiya_Lok_Kala_Mandal_Udayapur, 164 pages. Barcode 5010010005560   Server error, availability unknown.

2864. Rangayan Vol 34  Bagaiah .m; Temples, 2001, M.Srikant Kumar - Hyderabad, 164 pages. Barcode 5010010007429   Scan not available.

2865. Rangayan Vol 34 Jan-june 2001  Durgesh Singhal; Unknown, 2002, Penmain Publications,Delhi, 164 pages. Barcode 5010010001508   Scan not available.

2866. Rangayan Vol 34 Jan-june 2001  Kavignar - Vaarasree; Unknown, 1992, Mayar Pathippagam, Chennai,  pages. Barcode 5010010002936   Scan not available.

2867. Ras Gangadhara  Pandit Sri Bhadarinath Jha; Unknown, 1955, Chaukamba_Vidhya_Bhavan, 426 pages. Barcode 2020010007136   Scan available.

2868. Rasa Mitra  tryambak nath sharma; Technology, 1965, shiva narayana upadhya, 276 pages. Barcode 2020050036032   Scan not available.

2869. Rasa Mitra  tryambak nath sharma; Technology, 1965, shiva narayana upadhya, 382 pages. Barcode 2020050036033   Scan not available.

2870. Rasa-jala-nidhi  Bhudeb Mookerjee; Temples, 2001, CALCUTTA UNIVAERSITY,CALCUTTA, 427 pages. Barcode 5010010007431   Scan not available.

2871. Rasaand-avasudhaakar  ta gand-apatishaasitrand-aa; LANGUAGE. LINGUISTICS. LITERATURE, 1916, raajakiiyamudrand-ayantraalayei tadadhayaqs-eind-a mudrayitvaa prakaashitamuu, 340 pages. Barcode 5010010078794   Scan available.

2872. Rasachandrika  pande v; Language. Linguistics. Literature, 1913, jayakrishnadas haridas gupta, 110 pages. Barcode 2020050036048   Scan not available.

2873. Rasachandrika  parbatiya pandita vishweswara pandeya; Language. Linguistics. Literature, 1926, Vidya Vilas Press, Benares, 108 pages. Barcode 5010010028264   Scan not available.

2874. Rasadiirdhikaa  kavi vidhyaaraama; Language. Linguistics. Literature, 0, raajasthaana praachyavidhyaa pratishht'haana, jodhpuuru, 102 pages. Barcode 5010010028248   Scan not available.

2875. Rasadiparigyan  jaganath prasada shukla vaid; Natural Sciences, 0, the chowkhamba sanskrit series banaras, 174 pages. Barcode 2020050036397   Scan not available.

2876. rasagad'gadhara  naagesha bhat'at'a; Literature, 1824, Nirnayasagar Press , Mumbai, 538 pages. Barcode 5010010091931   Scan available.

2877. rasagad'gadhara dwitiiya san'skarand-am  pand-d'ita durgaaprasaadena; Literature, 1894, Nirnayasagar Press , Mumbai, 544 pages. Barcode 5010010092149   Scan available.

2878. Rasagadagdar Rahasyam  Sri madanmohan Jha; Unknown, 999, CHOUKHAMBA AMARBHARTI PUBLICAIONS, 60 pages. Barcode 2020010013130   Server error, availability unknown.

2879. Rasagan'gaadharahrudayamu  jnj-aanachandrastyaagii; Language. Linguistics. Literature, 1964, Chowkamba Sanskrit Series Office, Bombay, 138 pages. Barcode 5010010028223   Scan not available.

2880. Rasagangadhar  jaganath; Language. Linguistics. Literature, 0, chowkhamba sanskrit series office varanasi, 430 pages. Barcode 2020050036089   Scan not available.

2881. rasagangadhara  kasinatha panduranga paraba; Religion, 1894, Nirnaya Sagar Press, Bombay, 405 pages. Barcode 5010010087208   Scan not available.

2882. Rasagangadhara  Dr. Srinarayan Misra; Unknown, 1996, Krishanadasa_Akadamy, 403 pages. Barcode 2020010013131   Server error, availability unknown.

2883. Rasahrxdayatantrama  Shriigovindabhagavatpaada; Language. Linguistics. Literature, 1927, Moti Lal Band'aarii Dasa~ Da Panjaaba~ San'skrxta~ Buka~ D'ipot'a~, 206 pages. Barcode 2030020016430   Scan not available.

2884. Rasamajjarii  bad'ri natha; LANGUAGE. LINGUISTICS. LITERATURE, 1929, Sri Hari Krishna Nibandh Bhawan , Benares, 222 pages. Barcode 5010010042512   Scan not available.

2885. Rasamanj-jari Faskikyuulasa~ 3  Bhaanubhat't'aa Shrii; Technology, 1904, Vidya Vilaasa~ Presa~, 100 pages. Barcode 2030020016540   Scan not available.

2886. Rasamanjari Of Bhanudatta  Ram Suresh Tripathi; Unknown, 1981, VIVEKA PUBLICATIONS, 332 pages. Barcode 2020010007132   Scan available.

2887. Rasamiimaan'sa  aachaarya raamachandrashuklaa; Language. Linguistics. Literature, 0, kaashii naagariiprachaarind-iisabhaa, 516 pages. Barcode 5010010017368   Scan not available.

2888. Rasaratnapradiipikaa Gran'thang-ka 8  Allaraaja; Language. Linguistics. Literature, 1945, Bhaaratiiya Vidhyaa Bhavana~, 100 pages. Barcode 2030020016393   Scan not available.

2889. rasasadanabhaand-a  durgaaprasaada; Literature, 1893, Nirnayasagar Press , Mumbai, 170 pages. Barcode 5010010092078   Scan available.

2890. Rasasadanabhaand-an  yuvaraaja; Language. Linguistics. Literature, 1893, Tukaram Javaji,Bombay, 70 pages. Barcode 5010010032868   Scan not available.

2891. Rasavilas  bhudeva sukla; Language. Linguistics. Literature, 1952, poona oriental book house, 162 pages. Barcode 2020050057961   Scan not available.

2892. Rasaviveka of Kavya Darsa  Sudarsanacharya. T.k.v.n; Literature, 1956, T.T.D Tirupati, 146 pages. Barcode 5010010007434   Scan not available.

2893. Rasen'drasaarasan'graha Bhaashhaat'iikaasahita  mahaamahopaadhyaaya gopaalakrxshhnd-abhat't'a suuri; Religion. Theology, 1844, laqs-miiven'kat'eshvara chhaapekhaana mun'bayii, 528 pages. Barcode 5010010025900   Scan not available.

2894. Rasendra Sarsangra  -; Unknown, 999, -, 500 pages. Barcode 2020010007135   Scan available.

2895. Rashtriya Panchang  -; Unknown, 1883, The_Director_General_Av_Abujavertris, 152 pages. Barcode 2020010007137   Scan available.

2896. Rastrapala Pariprccha Sutra Du Mahayana  L Finot; Unknown, 1992, Motilal_Banarsidass, 94 pages. Barcode 2020010007140   Scan available.

2897. Ratiratna Pradiipika  liilaadhara sharma; Language. Linguistics. Literature, 1930, Sri Venkateshvara Pustak Agencies, Culcutta, 148 pages. Barcode 5010010028250   Scan not available.

2898. Ratna Dipika And Ratna Satram  Ramasastri,p.s; Philosarhy, 1951, GOVERNAMENT ORIENTAL MANUSCRTPTS LIBRARY(MADRAS), 75 pages. Barcode 5010010007436   Scan not available.

2899. Ratna Samuchchaya  not availabe; Language. Linguistics. Literature, 1928, Published in India and Abroad, 504 pages. Barcode 5010010024939   Scan not available.

2900. Ratnaavali Kii Kathaavastu  Not available; Language. Linguistics. Literature, 0, Not available, 366 pages. Barcode 5010010028252   Scan not available.

2901. Ratnaavalinaat'ikaa  shriiharshhadeva; Language. Linguistics. Literature, 1953, samskrita saahitya sadana, bangalore, 216 pages. Barcode 5010010024938   Scan not available.

2902. Ratnaavalinaat'ikaa  shriiharshhadeva; Language. Linguistics. Literature, 1953, samskrita saahitya sadana, bangalore, 270 pages. Barcode 5010010028208   Scan not available.

2903. Ratnadiipikaa Ratnashaastrama~cha  Budhdabhat't'a Chand-deshvara~ cha; Geography. Biography. History, 1951, Da Shriivathsa Presa~, 84 pages. Barcode 2030020016466   Scan not available.

2904. ratnaketuudayam  pand-ita naaraayand-a; Literature, 1892, Not available, 366 pages. Barcode 5010010092049   Scan available.

2905. Ratnakiirtinibandhaavalii Volume Iii  anantalala t'haakuura; Religion. Theology, 1957, Kashi Prasad Jayaswal Research Institute , Patna ., 220 pages. Barcode 5010010012688   Scan not available.

2906. ratnaprabhaashhitam  Not available; Literature, 1867, Not available, 334 pages. Barcode 5010010092086   Scan available.

2907. ratnaprabhaashhitam bhaaga 2  Not available; Literature, 1875, Not available, 410 pages. Barcode 5010010092160   Scan available.

2908. Rattamatam  h. sesha iyengar; Language. Linguistics. Literature, 1950, government oriental manuscripts library madras, 174 pages. Barcode 5010010018070   Scan not available.

2909. Rauravaagaamaa Vol.i  yan.aar bhat't'a; Language. Linguistics. Literature, 1961, Institute Francais Dindologie, Pondichery, 277 pages. Barcode 5010010024940   Scan not available.

2910. Rauravaagaamaa Vol.ii  yan.aar bhat't'a; Language. Linguistics. Literature, 1972, Institute Francais Dindologie, Pondichery, 366 pages. Barcode 5010010024941   Scan not available.

2911. Rauravagama Volume I  N R Bhatt; Language. Linguistics. Literature, 1961, Institute Francais Dindologie , Pondichery ., 266 pages. Barcode 5010010012540   Scan not available.

2912. Ravanarjuniyamu  sri bhattabeem; Unknown, 999, tukaram jawaji, 220 pages. Barcode 2020010007154   Scan available.

2913. Ravi-vichaar  Vidhydhar Johrapoorkar; Religion. Theology, 1974, -, 552 pages. Barcode 2020050017229   Scan available.

2914. Reader I  K.l.v.sastri; Unknown, 2001, R.S.VADHYAR amp SONS, 128 pages. Barcode 2020010013157   Server error, availability unknown.

2915. Reader Ii  K.l.v.sastri; Unknown, 2001, R.S.VADHYAR amp SONS, 129 pages. Barcode 2020010013156   Server error, availability unknown.

2916. Reader Iii  K.l.v.sastri; Unknown, 1997, R.S.VADHYA amp SONS, 133 pages. Barcode 2020010013155   Server error, availability unknown.

2917. Rediscovering India Manav Dharma Shastra Vol 30 I  Haughton G.c; Unknown, 1987, COSMO PUBLICATIONS, 231 pages. Barcode 2020010013169   Server error, availability unknown.

2918. Regved Sanhita Vol- I  Ramgovind Trivedi Vedanthshastry; Unknown, 1988, Vaidika_Pustakalay, 964 pages. Barcode 2020010007174   Scan available.

2919. Remarks Of Similes In Sanskrit Literature  Gonda; Unknown, 1949, E_J_Brill, 134 pages. Barcode 2020010007178   Scan available.

2920. Remarks On The Sanskrit Passive  J Gonda; Unknown, 1951, E_J_Brill, 116 pages. Barcode 2020010007179   Scan available.

2921. Rg Bhasya Sangraha  Dev Raj Chanana; Unknown, 1961, Munshi Ram Manohar Lal, 354 pages. Barcode 2020010007227   Scan available.

2922. Rgarthasara Of Dinakara Bhatta Vol 1  Aryendra Sharma; Unknown, 1959, The_Sanskrit_Academy, 82 pages. Barcode 2020010007225   Scan available.

2923. Rgarthasara Vol I  Dinakara Bhatta; Unknown, 1959, The Sanskrit Academy, 82 pages. Barcode 2020010007226   Scan available.

2924. Rgveda Samhita Vol 4  Narayana Sharma; Art, 1868, Vaidik_Samshodan_Mandal, 148 pages. Barcode 5010010005579   Server error, availability unknown.

2925. Rgveda Samhita Vol-i  Sri Mathsainacharyavirchitbhasyasameta; Unknown, 999, Vaidika_Samshodana_Mandala, 1152 pages. Barcode 2020010007228   Scan available.

2926. Rgvedasamhita  Late Dr.lakshman Sarup; Unknown, 1955, Mothilal_Banarsidass, 1204 pages. Barcode 2020010007229   Scan available.

2927. Rgvedi Purva Proyoga  V S Venkata Raghavacharya; Religion. Theology, 1986, V S Venkata Raghavacharya, Madras, 188 pages. Barcode 5010010005582   Server error, availability unknown.

2928. Rig Veda Samhita Volume Iv Mandala X  max muller f ed; Religion. Theology, 1892, henry frowde, 732 pages. Barcode 2020050036382   Scan not available.

2929. Rigbhaashhya Bhuumika  vi. kapaali saastri; Language. Linguistics. Literature, 1952, M.P. Padit Sri Aurobindo Ashram, Pondicherry, 284 pages. Barcode 5010010024942   Scan not available.

2930. Rigved  Sri Rama Sharma. P; Vedas, 1965, Samskruti Samsthan, Bareli, 241 pages. Barcode 5010010007452   Scan not available.

2931. Rigveda Samahita (Manuscript)  Not Available; Language. Linguistics. Literature, 999, Not Available, 830 pages. Barcode 5010010029981   Scan not available.

2932. Rigveda Samhita  f max muller ed; Religion. Theology, 1890, his highness the maharajah of vijayanagara, 974 pages. Barcode 2020050058013   Scan not available.

2933. Rigveda Samhita  Sayanas Comentary; Unknown, 1951, Choukambha_Publishers, 594 pages. Barcode 2020010007237   Scan available.

2934. Rigveda Samhita  Srit.v.kapali Sastry; Unknown, 1951, Sri_Aurobinda_Ashram_Press, 1314 pages. Barcode 2020010007238   Scan available.

2935. Rigveda Samhita Vol Iii 6 8 Mandalas  Sayanacharya; Unknown, 1941, Vaidika_Samshodhana_Mandala, 1074 pages. Barcode 2020010007234   Scan available.

2936. Rigveda Samhita Vol Iv Ix X Mandalas  Sayanacharya; Unknown, 1946, Vaidika_Samshodhana_Mandala, 1108 pages. Barcode 2020010007235   Scan available.

2937. Rigveda Samhita Vol-ii 2-5 Mandalas  Sayanacharya; Unknown, 1936, Vaidika_Samshodhana_Mandala, 1058 pages. Barcode 2020010007233   Scan available.

2938. Rigveda Samhita Vol-v Indices  Sayanacharya; Unknown, 1951, Vaidika_Samshodhana_Mandala, 1140 pages. Barcode 2020010007236   Scan available.

2939. Rigvedasanhitoupanishadchatakam  -; Religion. Theology, 0, -, 490 pages. Barcode 2020050058006   Scan not available.

2940. Rigvedasya Prathamamanadalasya Sayana Venkatamadhava Bhasyayos  Pramodhini Panda; Rigveda, 2000, Shaiva Bharati Shoda Prathishthanam, 249 pages. Barcode 5010010007448   Scan not available.

2941. Riitikaalina Kavitaa Men' Abhivyaan'janaa Evan' Shilya  Not available; Language. Linguistics. Literature, 1966, shrii ven'kat'eshvara vishvavidyalaya tirupatii, 491 pages. Barcode 5010010018071   Scan not available.

2942. Riksan'graah Trxtiiya Khand-d'a  Bijapurakara Vishnd-u Govinda; Religion. Theology, 1929, Javajii Paan'd'uran'ga, 298 pages. Barcode 2030020016048   Scan not available.

2943. Ritriratna Prakash  Kamakshi; Dharmasthala, 1986, Kamakshi Amma Kumbakonam, 102 pages. Barcode 5010010001528   Server error, availability unknown.

2944. Rkbhasyam Chalari  Krishnacharya,t.r; Unknown, 1823, Nirnaya Sagar Press, Mumbai, 429 pages. Barcode 5010010010735   Scan not available.

2945. Rkbhasyam Tika  Krishnacharya,t.r; Unknown, 1823, Nirnaya Sagar Press, Mumbai, 770 pages. Barcode 5010010010734   Scan not available.

2946. Rksamhita  Unknown; Unknown, 999, Unknown, 283 pages. Barcode 5010010010731   Scan not available.

2947. Rksamhita  Unknown; Journals, 999, Unknown, 1242 pages. Barcode 5010010010732   Scan not available.

2948. Roopdeepika  Ramanand Divvedina; Unknown, 1986, Chowkhamba_Orientaliya, 32 pages. Barcode 2020010007243   Scan available.

2949. Rubaiyat Of Omar Khaiyam  A Narayanadas; Language. Linguistics. Literature, 1932, Sree Viziarama Gana Patasala , Vizianagram, 362 pages. Barcode 5010010013012   Scan not available.

2950. Rudraadhyaaya Bhaashhya Etatpustakan  saayand-aachaaryabhat't'a; Language. Linguistics. Literature, 1976, Not available, 186 pages. Barcode 5010010028245   Scan not available.

2951. Rudraadhyaaya Grantha 2  Aapat'e Hari Naarayand-a; Religion. Theology, 1935, Aananda Shramamudrand-aalaye, 176 pages. Barcode 2030020016023   Scan not available.

2952. Rudradasas Chandralekha  Dr A N Upadhye; Unknown, 1945, BHARATIYA VIDHYA BHAVAN, 170 pages. Barcode 2020010007250   Scan available.

2953. Rudrasthadhyayi  Sri Pandith Jwalaprasad; Unknown, 999, Sri Venkateshwar Steem Press, 158 pages. Barcode 2020010007252   Scan available.

2954. Rukminikalyana Mahakavya  Sri Balayajnavedesvara; Unknown, 1929, Published_For_The_Adyar_Library, 200 pages. Barcode 2020010007255   Scan available.

2955. Rukminikalyana Mahakavya Of Rajacudamani Diksita  Sri Rama Sharma. P; Literature, 1929, The Adyar Library,Madras, 242 pages. Barcode 2020010021767   Scan available.

2956. Rukminishavijayahaha  Unknown; Language. Linguistics. Literature, 999, Unknown, 454 pages. Barcode 5010010010730   Scan not available.

2957. Rupachandrikaa  ramachandrajhaa vyaakarand-aachaayra; Religion. Theology, 999, cchokhambaa shan'rukuta shiiriija aaphisa vaaraand-asii, 318 pages. Barcode 2020050017190   Scan not available.

2958. Rupachandrikaa  ramachandrajhaa vyaakarand-aachaayra; Religion. Theology, 999, cchokhambaa shan'rukuta shiiriija aaphisa vaaraand-asii, 672 pages. Barcode 2020050017194   Scan available.

2959. Ruupamaalaayaamu Bhaage Iii  not Available; Language. Linguistics. Literature, 1982, Ganga Vishnu SriKrishna Das, Bombay, 70 pages. Barcode 5010010028254   Scan not available.

2960. Rxgaratna Bhaand-d'aara  Kolan'gad'e Raamachan'dragovin'da; Religion. Theology, 1951, Kolan'gad'e Aand-i Kan'pand-ii, 641 pages. Barcode 2030020016407   Scan not available.

2961. Rxgara~thadiipika Chatura~tho Bhaaga  Shriimadhavaa; Religion. Theology, 1955, Motiilaala~ Banaarasiidaasa Orient'ala~ Buksa~ Sellara~sa~ aura~ Pablishara~sa~, 1219 pages. Barcode 2030020016532   Scan not available.

2962. Rxgara~thadiipikaa Chatura~tho Bhaaga  Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena; Religion. Theology, 1955, Motiilaala Banaarasiidaasa Ityetai Mudranalaye Mudraapayitvaa Prakaashita, 1208 pages. Barcode 2030020016216   Scan not available.

2963. Rxgara~thadipika Bhaaga 2  Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena; Religion. Theology, 1940, Motiilaala Banaarasiidaasa Orient'ala~ Pabliishara~sa, 736 pages. Barcode 2030020016215   Scan not available.

2964. Rxgbhaashhya  Not available; Religion. Theology, 0, Not available, 73 pages. Barcode 5010010024945   Scan not available.

2965. Rxgbhaashhyasan'graha  sva d'aa devaraaja chaananaa; Language. Linguistics. Literature, 0, munshiiraama manoharalaala, nayii dillii, 440 pages. Barcode 5010010025901   Scan not available.

2966. Rxgveda Prathamos-shht'aka Chatuthes-shht'ake Shhashht'os-dhyaaya  Not Available; Language. Linguistics. Literature, 999, Not Available, 952 pages. Barcode 5010010029067   Scan not available.

2967. Rxgveda San'hiita Shashht'o Bhaagaa  Vilsana~ Hecha~ Hecha~; Language. Linguistics. Literature, 1928, Bhagavat Havusa~ Da Bangulore Presa~, 450 pages. Barcode 2030020016423   Scan not available.

2968. Rxgveda San'hitaa Bhaaga 2  Santavalekara~ Shriipaada Daamodara~; Religion. Theology, 1940, Bhaaratha~ Mudrand-aalayama~ Aundha Nagarama~, 1062 pages. Barcode 2030020016213   Scan not available.

2969. Rxgveda San'hitaa Part I  daamodara bhat't'a; RELIGION. THEOLOGY, 0, Bharatamudranalayam , Nagaram, 776 pages. Barcode 5010010042516   Scan not available.

2970. Rxgveda San'hitaa Part Ii  daamodara bhat't'a; RELIGION. THEOLOGY, 1940, Bharatamudranalayam , Nagaram, 978 pages. Barcode 5010010042570   Scan not available.

2971. Rxgveda San'hitaa Prathamo Bhaaga  Shaastri T'i Vi Kapaali; Religion. Theology, 1950, Maadhava Pund-d'alok Pand-d'ita, 352 pages. Barcode 2030020016203   Scan not available.

2972. Rxgveda San'hitaa Trxtiiyo Bhaaga  Shriimatsaayand-aachara~ya; Religion. Theology, 1966, chaukhambaa San'skrxta Siiriija aaphisa vaarand-asii, 914 pages. Barcode 2030020016209   Scan not available.

2973. Rxgveda Sn'hitaa  Shriipaadashara!~mand-aa Bhat't'aachayaind-a; Religion. Theology, 1950, Bhaaratamudrand-aalaye Mudrayitvaa, 1058 pages. Barcode 2030020016308   Scan not available.

2974. Rxgvedaa Vyakhyaa Maadhavakara~ta  Raajaa Kunahaana; Religion. Theology, 1939, Adayaara Laibarrii, 502 pages. Barcode 2030020016140   Scan not available.

2975. Rxgvedaanukramand-ii  kunjanuu raajena; RELIGION. THEOLOGY, 1932, University Of Madras , Madras, 160 pages. Barcode 5010010042510   Scan not available.

2976. Rxgvedaanukramand-ii Prathamo Bhaaga Grantha 2  Bhat't'ena Maadhava; Religion. Theology, 1931, Kunj-jana~ Raajena, 374 pages. Barcode 2030020016087   Scan not available.

2977. Rxgvedasan'hitaa Pdaadisuuchyaatmakah Panj-chamo Bhaaga  Sont'ake Esa~ena~; Religion. Theology, 1951, Samara~tha Bhaarata Presa~, 1151 pages. Barcode 2030020016483   Scan not available.

2978. Rxgvedasan'hitaa Prathamaashht Akama~ Prathamo Bhaagaa  Shriikapaalishaastrii; Natural Sciences, 1940, Nandinii Mudrand-aalayan', 353 pages. Barcode 2030020016523   Scan not available.

2979. Rxgvedasan'hitaa Prathamaashht'akama~  Shriikapaalishaastrii; Religion. Theology, 1957, Maadhavapund-d'alika Pand-d'ita Shrii Aravindaashrama, 602 pages. Barcode 2030020016222   Scan not available.

2980. Rxgvedasan'hitaa Prathamashht'akama~ Prathamo Bhaaga  Shriikapaalishaastri; Religion. Theology, 1950, Nandinii Mudrand-aalayan', 353 pages. Barcode 2030020016531   Scan not available.

2981. Rxgvedasan'hitaa Trxtiiyo Bhaaga  Matsaayand-aachaara~ya; Religion. Theology, 1941, Ena Esa Sonat'akke, 1142 pages. Barcode 2030020016181   Scan not available.

2982. Rxgvedasan'hitaa Trxtiiyobhaaga  shriimatsaayand-achaara~yaa; Religion. Theology, 1913, Vaidik~ san'shodhana Mand-d'alena, 1072 pages. Barcode 2030020016205   Scan not available.

2983. Rxgvedasan'hitaapadapaat'hah  Raamaanuja Jaiyasaragomat'han; Religion. Theology, 1947, Karonashhana Mudrand-aalaye, 949 pages. Barcode 2030020016565   Scan not available.

2984. Rxgvedavyaakhyaaya Bhaaga 2 Ast'aka 1 Adhyaayaasa~ 5 Se 8  Maadhavakara~ta; Language. Linguistics. Literature, 1947, Vasantaa Presa~, 370 pages. Barcode 2030020016492   Scan not available.

2985. Rxgvedavyaakyaa  Madhavaka~ra~ta; Religion. Theology, 1939, Da Vasantaa Presa~, 500 pages. Barcode 2030020016497   Scan not available.

2986. Rxgveida Bhaashhyamu Volume 15  udgita aachaarya; Language. Linguistics. Literature, 1935, The D . A . V . College Research Department , Lahore ., 124 pages. Barcode 5010010012603   Scan not available.

2987. Rxgveida Prathamoshht'aka  raamachandravinaayaka pat'avardhana; Language. Linguistics. Literature, 0, shrutibodhakaaryaalaya mumbaapuuryaa, 772 pages. Barcode 5010010018058   Scan not available.

2988. Rxgveidasan'hitaa Chaturthoo Bhaaga  Not available; Language. Linguistics. Literature, 1867, Not available, 1111 pages. Barcode 5010010017773   Scan not available.

2989. Rxgveidasan'hitaa Dvitiiyoo Bhaaga  shriimatsaayand-aachaarya; Language. Linguistics. Literature, 1858, Not available, 1062 pages. Barcode 5010010017765   Scan not available.

2990. Rxgveidasan'hitaa Panchamoo Bhaaga  Not available; Language. Linguistics. Literature, 1873, Not available, 1147 pages. Barcode 5010010017766   Scan not available.

2991. Rxgveidasan'hitaa Prathamoo Bhaaga  Not available; Language. Linguistics. Literature, 0, tilaka mahaaraashht'a vidhyaapiit'ha, 1148 pages. Barcode 5010010017767   Scan not available.

2992. Rxgveidasan'hitaa Trxtiiyoo Bhaaga  Not available; Language. Linguistics. Literature, 1863, tilaka mahaaraashht'a vidhyaapiit'ha, 1056 pages. Barcode 5010010017768   Scan not available.

2993. rxgvidhaanamahimaa  shriikrxshhnd-amuurtishaastriind-a; Literature, 1869, Not available, 216 pages. Barcode 5010010091920   Scan available.

2994. Rxktantran' Saamapraatishaakhyam  Surya Kanta Shastri; Language. Linguistics. Literature, 1933, Mehar Chand Lachhman Das Sanskrit Book Depot, Lahore, 313 pages. Barcode 5010010029080   Scan not available.

2995. Rxkuusuuchii  Not available; Religion. Theology, 0, Not available, 20 pages. Barcode 5010010024946   Scan not available.

2996. Rxtuvarnd-ana Vyaakhyaaya  durlabhaa; Language. Linguistics. Literature, 1969, adyar library and research center, madras, 64 pages. Barcode 5010010028255   Scan not available.

2997. Rxveda San'hitaa Bhaaga 1  shrisaayand-aachaarya; Religion. Theology, 1933, indian research institute, calcutta, 180 pages. Barcode 5010010024948   Scan not available.

2998. Rxvedavyaakhyaa Bhaaga 2 Ashtaka 1 Adhyaaya 5 8  madhava; Religion. Theology, 1947, Adyar library and research center Madras, 362 pages. Barcode 5010010024947   Scan not available.

Return to the top

S


2999. s.v.u oriental journal vol-1  prof.j.chenna reddy; Indology, 1958, S.V. University Tirupati, 217 pages. Barcode 5010010001880   Scan not available.

3000. S.v.u.oriental Journal Vol-4 Part 1 ,2  Purushottam.t.a; Indology, 1961, S.V.U. Oriental Research Institute Tirupati, 189 pages. Barcode 5010010007932   Scan not available.

3001. Saadaashivabhaashhyama~  Virachita Nanj-jund-d'aaraadhya; Religion. Theology, 1951, Prabodha Pustakamaalaa, 285 pages. Barcode 2030020016329   Scan not available.

3002. Saahitya Darpand-a  krxshhnd-amoohan shaastri; Language. Linguistics. Literature, 1955, Chowkamba Sanskrit Siirij Office, Banaras, 939 pages. Barcode 5010010028198   Scan not available.

3003. saahitya darpand-a  Not available; Literature, 1865, Not available, 658 pages. Barcode 5010010092121   Scan available.

3004. Saahityadaprand-ama  aachaariya sheshharaajashamaa regmii; General, 2005, krushhnd-adaasa ackaadamii vaaraand-asii, 1146 pages. Barcode 2020050017208   Scan available.

3005. Saahityadarpand-amu  Not available; Language. Linguistics. Literature, 0, Not available, 639 pages. Barcode 5010010012602   Scan not available.

3006. Saahityadarpand-amu Vyaakhyaamavalambaa Samudbhaasitamu Panj-chamasan'skarand-amu  shriivishvanaathakaviraaja; Language. Linguistics. Literature, 1900, kalikaataanagaryyaamu kalikaataayantre, 644 pages. Barcode 5010010024949   Scan not available.

3007. Saahityakaumudi  vidhyabhushand-a; LANGUAGE. LINGUISTICS. LITERATURE, 1897, Tukaram Javaji,Bombay, 234 pages. Barcode 5010010042388   Scan not available.

3008. saahityaratnamajjuushhaa  Not available; Literature, 1875, Not available, 189 pages. Barcode 5010010091948   Scan available.

3009. Saahityaratnaman'juushhaa  shriikuushhnd-a; LANGUAGE. LINGUISTICS. LITERATURE, 1908, Sri Vani Vilas Press , Srirangam, 194 pages. Barcode 5010010078238   Scan available.

3010. Saahityaratnamanj-jushhaa  shriikrxshhnd-asuurind-a; Language. Linguistics. Literature, 1908, shriirang-kanagare shriivaand-iivilaasamudrand-aalaya, 193 pages. Barcode 5010010024950   Scan not available.

3011. Saahityavimarsha Sakalasaahityaan'shasang-grahatmaka  uppalla someshvarasharma; Language. Linguistics. Literature, 1951, T.T.D Tirupati, 100 pages. Barcode 5010010024951   Scan not available.

3012. Saakhyakaarikaa  iishvara kushhnd-a; LANGUAGE. LINGUISTICS. LITERATURE, 1922, Chowkhamba Sanskrit Series Office , Benares, 109 pages. Barcode 5010010040955   Scan available.

3013. Saamaanya Bhaashhaavijnj-aana  Saksenaa Baaburaama; Language. Linguistics. Literature, 1943, Hindii Saahitya Sammelana, 197 pages. Barcode 2030020016412   Scan not available.

3014. Saamaanyaniruktti  t'iikaachatushht'ayasanaathii; Language. Linguistics. Literature, 0, Not available, 630 pages. Barcode 5010010025903   Scan not available.

3015. Saamaveda San'hitaa  Chaara~ya Saayand-a; Religion. Theology, 1917, Raamasvaruupa Shara~maa, 238 pages. Barcode 2030020016086   Scan not available.

3016. Saamaveda Uuhauuhyagaanamu Anubandhasahita Trxtiiyo Bhaaga San'put'amu 1  shrii vai raamamuurtishrautii; Language. Linguistics. Literature, 2002, shang-kara advaita shodhakendramu shrrxng-gagiri, 516 pages. Barcode 5010010026044   Scan not available.

3017. Saamaveda Uuhauuhyagaanamu Anubandhasahita Trxtiiyo Bhaaga San'put'amu 2  shrii vai raamamuurtishrautii; Language. Linguistics. Literature, 2002, shang-kara advaita shodhakendramu shrrxng-gagiri, 500 pages. Barcode 5010010026078   Scan not available.

3018. Saamavedasan'hitaa  Prof. C. Kunhan Raja; Language. Linguistics. Literature, 1941, The Adyar Library, 426 pages. Barcode 5010010029038   Scan not available.

3019. Saamavediiya Ashht'a Braahmand-e Saamavidhaanan' Aarshheyan'cha Gn-iiqs-aadi San'valitamu Dvitiiyo Bhaaga  Not available; Language. Linguistics. Literature, 1981, kumaara press, kun'bakoond-amu, 299 pages. Barcode 5010010026079   Scan not available.

3020. Saamavediiya Ashht'a Braahmand-e Taand-d'yamu Pad'avin'shabraahmand-an' Prathamo Bhaaga  Not available; Language. Linguistics. Literature, 1982, Not available, 1024 pages. Barcode 5010010026080   Scan not available.

3021. Saamavediiya Chandogyopanishhata~  Shara~maa Raamasvaruupa; Religion. Theology, 1934, Not Available, 543 pages. Barcode 2030020016163   Scan not available.

3022. Saamavediiya Jaiminiiya San'hitaa Bhaaga 3  Raghuviira~ Achaara~ya; Religion. Theology, 1938, Ara~yaabhaarati Presa~ Laahora~, 168 pages. Barcode 2030020016272   Scan not available.

3023. Saamavediiya Taand-d'yamahaabraahmand-ama~ Da~vitiiya Bhaaga  Sayanaachaara~yaa Shrii; Religion. Theology, 1936, Da Vidya Vilaasa Presa~, 702 pages. Barcode 2030020016528   Scan not available.

3024. Saamavediiyataand-jyamahaabrahmand-ama~ Prathama Bhaaga  Saayand-aachaara~yaa; Religion. Theology, 1935, Jayakrxshhnd-adaasa~ Haridasa Guptachaukambaa San'skrxta Siirija Aaphisa, 547 pages. Barcode 2030020016229   Scan not available.

3025. Saamaveidasan'hitaa Aagneiyakaand-akamuu Prathamoo Bhaaga  shriimadhvaachaarya; Language. Linguistics. Literature, 1973, shruti smrxti puraand-a prakaashana samitii, 327 pages. Barcode 5010010018009   Scan not available.

3026. Saamavidhaana Braahmanamuu  d'aa bii aar sharmaa; Language. Linguistics. Literature, 999, The Central Sanskrit Institute Tirupathi, 342 pages. Barcode 5010010017373   Scan not available.

3027. Saambapuuraand-amu Upapuraand-amu  d'aa shriikrxshhnd-amand-i tripaat'hii; Language. Linguistics. Literature, 1983, krxshhnd-adaasa akaadamii vaaraand-asii, 370 pages. Barcode 5010010026081   Scan not available.

3028. Saamyavaada  baabuu raamachandra; LANGUAGE. LINGUISTICS. LITERATURE, 1919, Hindi Grantha Ratnakara Kavyalaya , Bombay, 511 pages. Barcode 5010010042343   Scan not available.

3029. Saan'khyaakaarikaa  ji. thibaut'a; Language. Linguistics. Literature, 1906, Vidya Vilas Press, Benares, 96 pages. Barcode 5010010028183   Scan not available.

3030. Saang-kaadarshanamu  Not available; Language. Linguistics. Literature, 0, Not available, 222 pages. Barcode 5010010026083   Scan not available.

3031. Saang-khachaayanagrxhyasang-graha  shriivaasudevavidvadvara; Religion. Theology, 0, Not available, 98 pages. Barcode 5010010024953   Scan not available.

3032. Saaraavaali  -; General, 2005, vavilla ramaswamy sastulu, 400 pages. Barcode 2020050017219   Scan available.

3033. Saaraavali Kaantimati Hindii Vyaakhyaa Sahitaa  shriimatkalyaand-avarma; Language. Linguistics. Literature, 1989, motilaala banaarasiidasa, dilli, 580 pages. Barcode 5010010026045   Scan not available.

3034. Saaraavalii  shriimatkalyaand-avarmaa; Religion. Theology, 1907, tukaaraama jaavajii nirnd-ayasaagaramudrand-aalayamu mumbayyaan', 266 pages. Barcode 5010010017769   Scan not available.

3035. Saarasiddhaantakaumudii Raakaa San'skrxta Hndiivyaakhyaaya Dvitiiya Khand-d'a  shriimadvaradaraajaachaarya; Language. Linguistics. Literature, 1992, chaukhambhaa san'skrxta san'sthaana vaaraand-asii, 140 pages. Barcode 5010010026025   Scan not available.

3036. Saarasvata Vyaakarand-ama~ Uttaraaddhara~ma~  Svaruupaachaara~ya Anuubhuuti; Language. Linguistics. Literature, 1936, Jayakrxshhnd-adaasa Haridaasa Gupta, 359 pages. Barcode 2030020016034   Scan not available.

3037. Saarasvatavyaakarand-amuu  naaraayand-a raama aachaarya; Language. Linguistics. Literature, 1942, Nirnaya Sagar Press , Mumbai ., 310 pages. Barcode 5010010012601   Scan not available.

3038. Saarasvatiikand-t'haabharand-amu  not Available; Language. Linguistics. Literature, 0, Not Available, 751 pages. Barcode 5010010028236   Scan not available.

3039. Saaraswatham (vyakaranam)  Tippayya Parishkrit; Sterling Publishers Private Limited New Delhi, 1990, Patta prachin pustakalay Gopalvadi Mumbai, 387 pages. Barcode 5010010007459   Scan not available.

3040. Saaravyaayanagrxhyasang-graga Kaushhiitakigrxhyasuutrand-i  kausun'varavaastavyapand-d'itavara vaasudeva; Language. Linguistics. Literature, 1908, chaukhamba sanskrit series office, benares, 252 pages. Barcode 5010010024954   Scan not available.

3041. Saara~tha Upanishhatsan'graha Bhaaga Sahaava  Bhaagavata Hariraghunaatha; Religion. Theology, 1922, Ashht'ekara Kan'pani, 77 pages. Barcode 2030020016479   Scan not available.

3042. saariirakanyaayasan'graha By Prakasatmayati  T.r.chintamani; Philosophy. Psychology, 1939, The University of Madras, 194 pages. Barcode 5010010026438   Scan not available.

3043. saariirakavyaaravyaaprasthaanaani  V.s.v. Guruswamy; Philosophy. Psychology, 1940, V.S.V. Guruswamy, 62 pages. Barcode 5010010026437   Scan not available.

3044. saastradapend-amuu  Sri Amalananda; Philosophy. Psychology, 1913, Sri Vani Vilas Press, Srirangam, 414 pages. Barcode 5010010026436   Scan not available.

3045. Saastradiipikaa  laqs-and-a; LANGUAGE. LINGUISTICS. LITERATURE, 1916, Jai Krishnada Haridas Gupta , Benares, 476 pages. Barcode 5010010042545   Scan not available.

3046. Saata Inakalaabii Itavaar Bhaaga Tiisaraa  shriipataraaya; Language. Linguistics. Literature, 0, sarasvatiipres banaaras, 208 pages. Barcode 5010010017374   Scan not available.

3047. Saathar Upanishhatsn'grah 4 Bhaaga  Bhaagavata Hari Radhunaatha; Religion. Theology, 1922, Bhaagavata, 208 pages. Barcode 2030020016058   Scan not available.

3048. Saayand-iiyargvedabhaashhyabhuumikaayaa Vaadashiinaathii T'iikaa  pan' shriitrilokanaathamishra; Language. Linguistics. Literature, 1941, maast'ar khelaad'iilaala aind-d'a sansa, 108 pages. Barcode 5010010026026   Scan not available.

3049. Sabda Manjari  L Laxminarayan; Unknown, 1984, Sree_Vidhya_Publications, 126 pages. Barcode 2020010007276   Scan available.

3050. Sabda Manjari  K.l.v.sastry; Unknown, 2002, R.S.Vadhyar_ amp _Sons, 160 pages. Barcode 2020010013213   Server error, availability unknown.

3051. Sabda Sakti Prakasika  Pandit Dhundhiraj Sastri; Unknown, 1934, Jai Krishnadas Haridas Gupta, 492 pages. Barcode 5010010001540   Server error, availability unknown.

3052. Sabdakalpadruma Kanda Ii  Radhakanthadev; Religion. Theology, 1976, Ramanarayan_Press, 944 pages. Barcode 5010010005598   Server error, availability unknown.

3053. Sabdanusasana  Pandith Bechardas J Doshi; Unknown, 1967, Bharatiya_Sanskrithi_Vidhyamandir, 634 pages. Barcode 2020010007277   Scan available.

3054. Sabdapasabdavivekahaccn0 946  Chaturveda Shastry; Unknown, 1982, Nag Publishers,Delhi, 394 pages. Barcode 5010010001539   Server error, availability unknown.

3055. Sabdartha Ratnamu  Srotaranay Tarakavachaspati abhattacharya; Sanskrit Grammer, 1802, , 151 pages. Barcode 5010010007462   Scan not available.

3056. Sabdartna With Bhairavi  Unknown; Language. Linguistics. Literature, 999, Unknown, 498 pages. Barcode 5010010010729   Scan not available.

3057. Sabdha Koustubha  Pandit Bhatta Yogi Dikshit; Literature, 1917, Chowkambha Sanskrit Series Office, Benaras, 494 pages. Barcode 5010010007461   Scan not available.

3058. Sabhaashhyarxksan'hitaayaa Varnd-anukramasuuchii  Not available; Language. Linguistics. Literature, 1890, mun'bayyaa gand-apatakrxshhnd-ajiimudraayan'traalaya, 208 pages. Barcode 5010010024955   Scan not available.

3059. Sabhasha Arthavedika Vishaysoochi  -; Unknown, 999, -, 485 pages. Barcode 2020010007279   Scan available.

3060. Sabhashya Rathna Manjusha  Hari Damoder Velankar; Unknown, 1949, Bharathiya_Jnanapitha_Kashi, 88 pages. Barcode 2020010007280   Scan available.

3061. Sabhashyatatvarthadhigamsuthrah  Khubchandraji Siddhanthashasthri; Unknown, 1932, Shet_Manilalkwekhankar_Jagjeevan_Johari, 498 pages. Barcode 2020010007281   Scan available.

3062. Sachithra Yogaasan  brahmha charya raam; Language. Linguistics. Literature, 1930, babu soorajbhaan press, 202 pages. Barcode 2020050058033   Scan not available.

3063. Sachitra Jyotishha -Shiqs-aa  b.c thakur; General, 2005, motilal banarasidas, 270 pages. Barcode 2020050017197   Scan available.

3064. Sachitra Jyotishha Shiqs-a  b.c thakur; General, 2005, motiilaala banaarasiidaasa, 904 pages. Barcode 2020050017212   Scan available.

3065. Sachitra Jyotishha Shiqs-a  bii . ela . t'hakura; General, 2005, motiilaala banaarasiidaasa, 286 pages. Barcode 2020050017223   Scan available.

3066. Sachitra Jyotishha Shiqs-a  b.c thakoor; General, 2005, motilal banarasidas delhi, 252 pages. Barcode 2020050017226   Scan available.

3067. Sachitra Jyotishha-shiqs-aa  t'haakura jyotishhaachaariyaa; Religion. Theology, 999, motilaala banaarashiidaasa, 272 pages. Barcode 2020050017188   Scan not available.

3068. Sachurnika Srimad Bhagavatam  Unknown; Unknown, 1939, Gujarati Printing Press, 1886 pages. Barcode 5010010010677   Scan not available.

3069. Sacitra Prasuti Tantra  shivnath khanna; Unknown, 1981, chaukambha surbharathi prakashan, 814 pages. Barcode 2020010007284   Scan available.

3070. Sacred Books Of The Inndus Translated By Various Sanskrit Scholars  B.D. Basu; Religion, 1919, Sudhindra Natha Vasu The Panini Office, Bhuvaneswari Asrama, Bahadurganj, 126 pages. Barcode 5010010090009   Scan not available.

3071. sadaachaara t'iikaa  jaavaajii daadaajii; Literature, 1806, Nirnayasagar Press , Mumbai, 184 pages. Barcode 5010010092020   Scan available.

3072. Sadaashivaraavabhaauu  Bhuskut'e Vi Bha; Geography. Biography. History, 1945, Yaan'niin' Mudrand-aalaya, 292 pages. Barcode 2030020016301   Scan not available.

3073. Sadaashivendrastuti  shriisachchidaanandashivaabhinava; Language. Linguistics. Literature, 1908, shriirang-gasya shriivaand-iivilaasamudrayantraalaya, 164 pages. Barcode 5010010024956   Scan not available.

3074. Saddarsanasamuchchaya  Sri Haribhadrasiri; Unknown, 1957, Jaya_Krishnadas_Gupta, 84 pages. Barcode 2020010007287   Scan available.

3075. Saddharmapundarika  W.radloff; Unknown, 1911, Motilal Banarsidass Publishers, 142 pages. Barcode 2020010007289   Scan available.

3076. Sadguru sri Tyaga Brahma Pushpanjali  Pushpa Srivatsan; Stotras, 1994, T.T.D Tirupati, 408 pages. Barcode 5010010007463   Scan not available.

3077. Sagaud'a Paadiiya Kaarikaathara~va Vediiya Shhashht'hiya Khand-d'a Grantha 10  Bhagavata Shan'karaanan'da; Religion. Theology, 1936, Aanandaashramamudrand-aalaye, 249 pages. Barcode 2030020016167   Scan not available.

3078. Sahaavein' Pustaka  kai pan' vishhnd-u naaraayand-a bhaatakhan'd'ei; Language. Linguistics. Literature, 1937, Not Available, 572 pages. Barcode 5010010012539   Scan not available.

3079. Sahasra Yogaha  M.r.bhatt; Religion. Theology, 0, M.R.Bhatt_Mangalore, 266 pages. Barcode 5010010005602   Server error, availability unknown.

3080. Sahithya Darpan Of Vishvanatha Paricchedas I Ii X  P V Kane; Unknown, 1956, Panduranga_Vaman_Kane, 420 pages. Barcode 2020010007303   Scan available.

3081. Sahithya Rathna Kosah Thruthiya Khandamu  Nalinaksha Dutt; Unknown, 1962, Sahithya_Academy, 174 pages. Barcode 2020010007305   Scan available.

3082. Sahiti Jagathi  Kaloori Hanumanthrao; Unknown, 1973, -, 272 pages. Barcode 2020010007308   Scan available.

3083. Sahitya Darpan  Sri Durga Prasad Divyedaen; Unknown, 1982, MEHAR CHAND LAXMANDAS, 764 pages. Barcode 2020010007310   Scan available.

3084. Sahitya Darpan (Vimla)  -; Unknown, 999, -, 412 pages. Barcode 2020010007309   Scan available.

3085. Sahitya Darpanam  Not Available; The Arts, 0, Andhra Pradesh Sahitya Academy Hyderabad, 639 pages. Barcode 5010010011690   Scan not available.

3086. Sahitya Sudhalehari  T.narasimha Charya; Unknown, 1979, Kalpavalli_Publications, 188 pages. Barcode 2020010007318   Scan available.

3087. Sahitya Vimarsa  Aomesvara Sharma.a; Literature, 1951, T.T.D Tirupati, 101 pages. Barcode 5010010007465   Scan not available.

3088. Sahityaratnakara Of Dharmasuri Part I I  Dr B R Shastry; Unknown, 1974, SANSKRIT ACADEMY, 388 pages. Barcode 2020010007314   Scan available.

3089. Sahityaratnakara Of Dharmasuri Part I I I  Dr P Sri Ramachandrudu; Unknown, 1981, SANSKRIT ACADEMY OSMANIA UNIVERSITY, 450 pages. Barcode 2020010007313   Scan available.

3090. Sahityaratnakosh Abhilekha Sangrha  bhadhur chand chhabra; Language. Linguistics. Literature, 1964, sahitya akademi delhi, 138 pages. Barcode 2020050036088   Scan not available.

3091. Sahityaratnakosh Pradama Kand  vishva bhandu ed; Religion. Theology, 1966, sahitya akademi delhi, 430 pages. Barcode 2020050036051   Scan not available.

3092. Sahityasara  Sri Madachutaraya; Unknown, 1906, Tukaram_Jawaji, 558 pages. Barcode 2020010007317   Scan available.

3093. sahrxdayaanandam  tukaaraama jaavaajii; Literature, 1920, Nirnayasagar Press , Mumbai, 251 pages. Barcode 5010010091977   Scan not available.

3094. Sahstra Deepika Of Partha Sarathi Misra  Rama Krishana Misra; Unknown, 1913, Chowkhamba_Sanskrit_Book_Depot, 110 pages. Barcode 2020010007321   Scan available.

3095. Saitubandhamu  shriiraamadaasabhupatiprand-itadhaa; Language. Linguistics. Literature, 1895, Tukaram javaji, Bombay, 508 pages. Barcode 5010010032002   Scan not available.

3096. Sakalaagama Saara Sang-graha Shaiva Aagama  Not available; Language. Linguistics. Literature, 1974, south indian archaka sangam madras, 250 pages. Barcode 5010010028243   Scan not available.

3097. Sakalapuraand-aabhyarhita Shriibhaagavata Dashamaskandha Puurvaardhamu  shrii a vi narasin'haachaarya; Language. Linguistics. Literature, 1910, aanandamudraashaala, madras, 600 pages. Barcode 5010010026027   Scan not available.

3098. Sakhyakarikaa  shrii kuruganti veinkataramand-a shaastri; Language. Linguistics. Literature, 1955, Sundari Vilasa Samskrita Pathasala , Vemur ., 82 pages. Barcode 5010010012599   Scan not available.

3099. Sakuntala  Monier Williams; Unknown, 1961, THE CHOWKHAMBA SANSKRIT SERIES OFFICE, 188 pages. Barcode 2020010007332   Scan available.

3100. Salihotra Of Bhoja  ekanath dattatraya kulkarni; Unknown, 1953, s m katre, 94 pages. Barcode 2020010007333   Scan available.

3101. sam'qs-iptamahaabhaarata  C. V. Vaidya; LANGUAGE. LINGUISTICS. LITERATURE, 1921, Dattaram Ramchandra Sanzgiri, 516 pages. Barcode 5010010032474   Server error, availability unknown.

3102. Sam'skaaradiipaka Part I  Mahamahopadhyaya; Social Sciences, 1932, Jai Krishnadas Haridas Gupta, 263 pages. Barcode 5010010033706   Scan not available.

3103. Sam'skaaragand-apati Fasciculas Vi And Vii  Srirama Krishna; Language. Linguistics. Literature, 1937, Chowkhamba Sanskrit Series Benares, 202 pages. Barcode 5010010029792   Scan not available.

3104. Sam'skaaragand-apati Kandika Xii Of Kanda Ii  Yajnika Srirama Krishna Sarma; Language. Linguistics. Literature, 1938, Jaya Krishnadas Haridas Gupta, 296 pages. Barcode 5010010029752   Scan not available.

3105. Sam'skaararatnamaalaa Part I  Kasinath Sastri; Social Sciences, 1899, Hari Narayana Apte, 830 pages. Barcode 5010010033918   Scan not available.

3106. Sam'skaararatnamaalaa Part Ii  Kasinath Sastri; Social Sciences, 1899, Hari Narayana Apte, 855 pages. Barcode 5010010033974   Scan not available.

3107. Sama Veda Rahasya Ganam  Mayuram Sri M.ramanatha Deekshithar; Unknown, 1987, Sri C.P Ramaswami Iyer Foundation, 623 pages. Barcode 2020010013259   Server error, availability unknown.

3108. Samaarang-gand-asuutradhaara Prathama Bhaaga  Shriibhojadeva Mahaaraajaadhiraaja; Language. Linguistics. Literature, 1924, Shriidhara Pavara~ Presa~, 348 pages. Barcode 2030020016476   Scan not available.

3109. Samanya Vedanta Upanishad  Mahadevshatrin; Religion. Theology, 1921, Adayag Pustakalayart, 556 pages. Barcode 5010010009646   Scan not available.

3110. Samarad'gand-asutradhaara Bhaaga 2  Shriibhojadeva; Language. Linguistics. Literature, 1925, Sriidharaa Pavara~ Presa~, 364 pages. Barcode 2030020016321   Scan not available.

3111. Samarangara Sutradara Vasthu Sastram Mulamatram  0000; Linguistics Literature, 0, 0000, 226 pages. Barcode 5010010005609   Server error, availability unknown.

3112. Samarrngara Sutradara Vasthu Sastram Mulamatram  Jithendranath Shukla; Linguistics Literature, 1965, Meharchand_Lakshmandas_Delhi, 226 pages. Barcode 5010010005610   Server error, availability unknown.

3113. Samaskrit Basha Vibushanam  Sriramdeen Cheturrvedi; Unknown, 1963, Chowkhamba_Vidyabhawan, 144 pages. Barcode 2020010013276   Server error, availability unknown.

3114. Samasyaasamajyaa  mahaamahopaadhyaaya pan' raamashaastribhaagavataachaarya svaamii; Language. Linguistics. Literature, 1953, Not available, 110 pages. Barcode 5010010026028   Scan not available.

3115. Samaveda Samhita  V. Bhavavibhuti Bhattachary; , 1937, METROPOLITAN PUBLISHING HOUSE LIMITED, CALCUTTA, 98 pages. Barcode 5010010007477   Scan not available.

3116. Samaveda Samhita Volume Iv  Satyavarata Samasarami Bhattacharyyaa; Religion. Theology, 1983, Bibliotheca Indica , Calcutta, 587 pages. Barcode 5010010005611   Server error, availability unknown.

3117. Samavedasamhita  C. Subbrayudu; Unknown, 1935, VASANTA PRESS, MADRAS, 436 pages. Barcode 5010010001558   Scan not available.

3118. Samayasaara Bhaaga 8  shri kunda kunda acharya; Language. Linguistics. Literature, 1930, central jaina publishing house, lucknow, 236 pages. Barcode 5010010017770   Scan not available.

3119. Samayochita Padamaalika  gangadhara krishna draavida; Language. Linguistics. Literature, 1936, pandurang jawaji bombay, 84 pages. Barcode 2020050036399   Scan not available.

3120. Sambapuranam (Upapuranam)  Shrikrishanamani; Unknown, 1983, Lrishnadas_Academy, 407 pages. Barcode 2020010007351   Scan available.

3121. Samgita Rathnakara Vol 1  pandit s subramanya sastri; Unknown, 1943, the adyar library and research centre, 454 pages. Barcode 2020010007353   Scan available.

3122. Samgitaratnakara Vol I V Ashyaya 7  Pandith S Subrahmanya Sastri; Unknown, 1953, The_Adyar_Library_And_Research_Centre, 634 pages. Barcode 2020010007354   Scan available.

3123. Samkalpa Suryodaya Of Venkatanatha Part 1  Krishnamacharya,v; Literature, 1948, The Adyar Library,Madras, 736 pages. Barcode 5010010005626   Server error, availability unknown.

3124. samkalpa suryodaya part-2  krishnamacharya,v; Literature, 1948, The adyar library,madras, 417 pages. Barcode 5010010001559   Scan not available.

3125. Samkalpasuryadaya  Pandit V.krishnamacharya; Unknown, 1948, The_Adyar_Library, 424 pages. Barcode 2020010007357   Scan available.

3126. Samkalpasuryodaya Of Sri Venkatanatha  V.krishnamacharya; Art, 1948, The Adyar Library, 422 pages. Barcode 5010010005625   Server error, availability unknown.

3127. Samkhyayogadarsanam  Gosvami Damodara Sastri; Literature, 1990, Chaukhambha sanskrit sansthan,Varanasi, 288 pages. Barcode 5010010001544   Server error, availability unknown.

3128. Sampaadhya Prakaashataan' Niita  vimand-d'alavakra; Language. Linguistics. Literature, 0, Not available, 48 pages. Barcode 5010010028238   Scan not available.

3129. Samraat'uu Shubhaagamana  raajen'dranaatha pan'd'ita; Language. Linguistics. Literature, 1912, raajen'dranaatha pan'd'ita, 194 pages. Barcode 5010010012248   Scan not available.

3130. Samsara Chakram  ; , 999, , 102 pages. Barcode 5010010007495   Scan not available.

3131. Samsara Chakram  ; , 0, , 103 pages. Barcode 2020010021768   Scan available.

3132. Samskara Prakasika  Unknown; Language. Linguistics. Literature, 999, Unknown, 263 pages. Barcode 5010010010726   Scan not available.

3133. Samskaranrusimhaha  Unknown; Language. Linguistics. Literature, 1610, Ramnaraya Press,Calcutta, 440 pages. Barcode 5010010010725   Scan not available.

3134. Samskrit Baladarsa  Vidyasagar k L V Sastri; Unknown, 2002, R_S_Vadhyar_ amp _Sons, 104 pages. Barcode 2020010013275   Server error, availability unknown.

3135. Samskrita Akshara Siksha  R.balasubramanyam; Literature, 1992, Vangals Publications Bangalore, 84 pages. Barcode 5010010001561   Server error, availability unknown.

3136. Samskrita Swayam Sikshak Praba  Sri Gowrishankar Sastri; Unknown, 999, Chowkhamba_Vidyabhawan, 95 pages. Barcode 2020010013277   Server error, availability unknown.

3137. Samskritha Prathibha Vol I  -; Unknown, 1961, Sahitya_Academy, 166 pages. Barcode 2020010007368   Scan available.

3138. Samskrta Kavi Jivitam Part Ii  Pandit M Suryanarayana Shastry; Unknown, 1982, SANSKRIT ACADEMY, 384 pages. Barcode 2020010007369   Scan available.

3139. Samskrtu Vadumaya Kosa, Trutiya Kanda  Sridhar Bhaskar; Religion. Theology, 999, Bharatiya Basha Parushad, Calcutta, 323 pages. Barcode 5010010005613   Server error, availability unknown.

3140. Samskruta Sahitya Silanam  Dr. Ramji Upadhyaya; , 999, Samskruta Parishad, Sagar University, Sagar. M.P, 233 pages. Barcode 5010010007515   Scan not available.

3141. Samskruta Sukthi Sagar  Narayana Swamy; Linguistics Literature, 1965, Akhila Bharatiya Vikram Parishad, Kasi, 557 pages. Barcode 5010010001563   Scan not available.

3142. Samskruta Vanmaye Chandrah  Satya Srinivasa Ayyangar, V; Literature, 2000, Vedantam Hemalatha, Narasaraopet, 266 pages. Barcode 2020010021769   Scan available.

3143. Samskruta Vyakarana Sastra Ka Ithihas Part - 1  Yudishtar Mimasak; Linguistics Literature, 999, Ajmeer, 615 pages. Barcode 5010010001564   Scan not available.

3144. Samskruth Chittah Trutiya Bagh  -; Unknown, 999, -, 136 pages. Barcode 2020010007374   Scan available.

3145. Samskruth Natakome Athi Prakruth Thatv  Mulchandr Patak; Unknown, 999, Devanagar_Prakashan, 490 pages. Barcode 2020010007375   Scan available.

3146. Samskruth Sukthi Sagar  -; Unknown, 999, akhil bharathiy vikram parishad, 568 pages. Barcode 2020010007377   Scan available.

3147. Samskrutha Bhakthamala  Unknown; Language. Linguistics. Literature, 1986, Unknown, 452 pages. Barcode 5010010010724   Scan not available.

3148. Samskrutha Sikshamajyarayaha  Bhattacharya; , 1934, KALIKATHAMAHANGARIYAMA, 143 pages. Barcode 5010010007496   Scan not available.

3149. Samskruthapadamaala Trutiiya Kusumam  adi sankaracharya; Religion. Theology, 1973, Shankara Peetam, 75 pages. Barcode 5010010017244   Scan not available.

3150. Samtanantarasiddhi Vol Xix  Samtanantarasiddhitika; Unknown, 1992, Motilal Banarsidass Publishers, 154 pages. Barcode 2020010007379   Scan available.

3151. Samurtar Chanadhikarana: Atri Samhita  Atri Maharshi; Atri Samhita, 1953, T.T.D Tirupati, 603 pages. Barcode 5010010001566   Scan not available.

3152. Samvedika Sri Subhodini Paddhati  Samveda Vachaspathi; Unknown, 1941, Chowkhamba_Sanskrith_Series_Office, 386 pages. Barcode 2020010007383   Scan available.

3153. Samyasara Of The Nature Of The Self  Sri Kunda Kunda; Others - 33, 1950, BHARATIYA JNANAPITHA, KASHI DURGAKUND ROAD, BENARAS, 406 pages. Barcode 5010010005612   Server error, availability unknown.

3154. Samyasara Of The Nature Of The Self  Sri Kunda Kunda; Others - 33, 1950, BHARATIYA JNANAPITHA, KASHI DURGAKUND ROAD, BENARAS, 406 pages. Barcode 5010010007481   Scan not available.

3155. San'giitaratnaakara Etatpustakan' Kalaanidhyaaravyat'iikaasan'valita  shriinirang-kashaang-giideva; Language. Linguistics. Literature, 1897, aanandaashramamudrand-aalaya, 514 pages. Barcode 5010010026029   Scan not available.

3156. San'giitaratnaakara Kalaanidhyaaravyat'ikaa Prathamo Bhaaga  shriini shang-kashaang-giideva; Language. Linguistics. Literature, 1896, aanandaashramamudrand-aalaya, 490 pages. Barcode 5010010026046   Scan not available.

3157. San'kalpa Suuryoodaya  shrii vein'kat'anaatha; Language. Linguistics. Literature, 1948, The Adyar Library , Chennai ., 644 pages. Barcode 5010010012538   Scan not available.

3158. San'kalpasuuryodayanaat'akamuu Part I  krishand-amaachaari; LANGUAGE. LINGUISTICS. LITERATURE, 1919, E.J.Lazarus And Co , Benares, 255 pages. Barcode 5010010042582   Scan not available.

3159. San'karshha Kaand-d'amu Shhod'ashaadhyaaya Sheshhachaturadhyaayiisvaruupamu  jaiminii; Language. Linguistics. Literature, 1864, med'ikalhaala mudraalaya, 143 pages. Barcode 5010010025905   Scan not available.

3160. San'kashhiind-aayeipadishhat'aa  p b anantha chariar; LANGUAGE. LINGUISTICS. LITERATURE, 1902, sri sudarsana press , cojeeveram, 295 pages. Barcode 5010010079453   Scan available.

3161. San'pura~nd-a Aagarakara Bhaaga 2  Aalatekara Maadhava daamodara; Geography. Biography. History, 1947, Mad'ana~ Buka~ D'ipo, 267 pages. Barcode 2030020016418   Scan not available.

3162. san'qs-epa shaarirakamuu Vol 2 Adhayas 2 - 4  Sri Ramnath Sastri Vaidye; Philosophy. Psychology, 1917, Hari Narayan Apte for Anandha Ashram Publications, 460 pages. Barcode 5010010026435   Scan not available.

3163. San'qs-epasaariirakamu Vyaakhyaasamalang-krxtamu Prathamobhaaga  shriimatsarvagn-amuni; Language. Linguistics. Literature, 1971, vaaraand-asyaamu vidhyaavilaasa yantraalaya, 820 pages. Barcode 5010010025906   Scan not available.

3164. San'qs-epashaariirakama~ Da~vitiiyo Bhaaga  Sara~vajnj-aatmamuni; Philosophy. Psychology, 1918, Aanandaashramamudrand-aalayan', 462 pages. Barcode 2030020016333   Scan not available.

3165. San'qs-epashaariirakama~ Prathamaadhyaayarupa Prathamo Bhaga  Sara~jnj-aatmamuni; Philosophy. Psychology, 1918, Aanandashramamudrand-aalayan', 455 pages. Barcode 2030020016349   Scan not available.

3166. san'qs-epashaarirakamuu with Thatvabhodini Part 3  Sarvajnatma Muni; Philosophy. Psychology, 1938, Sarasvati Bhavana Series, Govt Sanskrit Library, Benares, 248 pages. Barcode 5010010026434   Scan not available.

3167. san'qs-epashaarirakamuu with Thatvabhodini Part 4  Sarvajnatma Muni; Philosophy. Psychology, 1939, Sarasvati Bhavana Series, Govt Sanskrit Library, Benares, 292 pages. Barcode 5010010026433   Scan not available.

3168. san'qs-epashaarirakamuu with Thatvabhodini Part 5  Sarvajnatma Muni; Philosophy. Psychology, 1941, Sarasvati Bhavana Series, Govt Sanskrit Library, Benares, 126 pages. Barcode 5010010026432   Scan not available.

3169. San'qs-ipta Vaalmikii Raamaayand-a Trxtiiyo Khand-d'a  Vaidaya Si Vi; Social Sciences, 1921, Raamachandra Govinda End-d'a San'sa, 331 pages. Barcode 2030020016101   Scan not available.

3170. San'skaara Paddhati Grantha 94  Shaastri Bhaaskara; Religion. Theology, 1924, Aanandaashramamudrand-aalaye, 270 pages. Barcode 2030020016196   Scan not available.

3171. San'skaaragand-apati  Pandit Sri Rama Krishna; Language. Linguistics. Literature, 1934, The Chowkhamba Sanskrit Series, 308 pages. Barcode 5010010029054   Scan not available.

3172. San'skaaramayuukha Ekaadasha  miimaan'sakashriinilakand-t'habhat't'a; Language. Linguistics. Literature, 1884, gujaraatii prin't'in'ga presa, ban'bayii, 183 pages. Barcode 5010010025907   Scan not available.

3173. san'skaararatnamaalaa  gopiinaathabhat't'iiti; Literature, 1898, Rajarajeswari Press , Benares, 194 pages. Barcode 5010010091949   Scan available.

3174. San'skaararatnamaalaa Uttaraara~dama~ Bhaaga 2  Bhat'a~t'agopiinaathadiiqs-ita; Religion. Theology, 1899, Aanandashramamudrand-alaye, 405 pages. Barcode 2030020016239   Scan not available.

3175. San'skaararatnamalaa Prathamo Bhaaga  Gopinathadiiqs-ita Bhat't'a; Religion. Theology, 1899, Aanandashramamudrand-alaye, 822 pages. Barcode 2030020016261   Scan not available.

3176. San'skaaravidhi Shhod'ashasan'skaarai  yagn-adatta; Language. Linguistics. Literature, 1947, prayaaga vaidikayantraalaya, 439 pages. Barcode 5010010028241   Scan not available.

3177. san'skruta saahitya itihaasan  Venkataramana Sastri; Literature, 1996, The Kuppuswami Sastri Research Institute, Madras, 274 pages. Barcode 5010010000240   Server error, availability unknown.

3178. San'skrutaavataaran  shriisholataataachaayaind-a; Language. Linguistics. Literature, 1926, Hindi Orachar Press, Madras, 68 pages. Barcode 5010010032599   Scan not available.

3179. san'skrutakaadambarikathaa  Neelakanta Shankar; Literature, 1979, Joshi Chitralaya Press Pune, 127 pages. Barcode 5010010004635   Server error, availability unknown.

3180. San'skrxta Kavi Jiivitamu  yam. suuryanaaraayand-a shaastri; General, 1950, Venkatrama And company, Vijayawada, 650 pages. Barcode 5010010028217   Scan not available.

3181. San'skrxta Naat'aka Udabhava Aura Vikaasa Siddhaan'ta Aura Prayoga  a. berriedale keith; Language. Linguistics. Literature, 1965, motilaala banaarasiidasa, dilli, 528 pages. Barcode 5010010024961   Scan not available.

3182. San'skrxta Saahitya Men' Saadrxshyamuulaka Alan'kaaron' Kaa Vikaasa  d'aa brahmaananda sharmaa; Language. Linguistics. Literature, 0, gavarnamend-t'a kaaleja ajamera, 430 pages. Barcode 5010010025911   Scan not available.

3183. San'skrxta Vyaakarand-a Shaastra Itihaasa Trxtiiya Bhaaga  Not available; Language. Linguistics. Literature, 1984, yudhishht'hira miimaan'saka soniipata, 340 pages. Barcode 5010010028244   Scan not available.

3184. San'skrxta Vyaakarand-a Shaastra Kaa Itihaasa Dvitiiyabhaaga  Not available; Language. Linguistics. Literature, 0, Not available, 522 pages. Barcode 5010010025912   Scan not available.

3185. San'skrxta Vyaakarand-ashaastra Kaa Itihaasa Prathamabhaaga  Not available; Language. Linguistics. Literature, 0, yudhishht'ira miimaan'saka soniipata, 770 pages. Barcode 5010010028242   Scan not available.

3186. San'skrxtaan'dhranighan't'uvu  Not available; Language. Linguistics. Literature, 1958, vi raamashaastrulu an'd' sans madraasu, 498 pages. Barcode 5010010025908   Scan not available.

3187. San'skrxtadvitiiyapaat'ha San'skrxtabhaashhaayaan' San'bhaashhand-ashiqs-aka  malliyan' raamaachaaryasuununaa; Religion. Theology, 1934, t. k. venkobaacharya, 100 pages. Barcode 5010010025909   Scan not available.

3188. san'skrxtaman'diraanta praveshikaa  bhaand-d'aarakaropaabhidhena gopaalasuununaa; Literature, 1861, Kalakatta Printing Press , Kalakatta, 272 pages. Barcode 5010010092167   Scan available.

3189. San'skrxtamandiraantah Praveshikaa  Bhaand-d'aarakara~ Raamakrxshhnd-agopala; Natural Sciences, 1931, Mangesha~ Aatmaaraama~ Saaguuna~,Raadhaabai aatmaaraama~ Saaguuna Buka~ Shellara~sa en'd'a Pablishara~, 312 pages. Barcode 2030020016429   Scan not available.

3190. San'skrxtapadyavali  Vaamana Kaane Paan'd'uran'ga; Language. Linguistics. Literature, 1934, Makamilana An'nd-d'a Kan'panii Limit'ed'a, 173 pages. Barcode 2030020016318   Scan not available.

3191. San'skrxtaprakaashikaa  naaraayand-aa; LANGUAGE. LINGUISTICS. LITERATURE, 1911, Not Available, 134 pages. Barcode 5010010078345   Scan available.

3192. San'skrxtavaachanapaat'hamaalaa Dvitiiya Khand-d'a  Gand-eshaa Shaastrii Laqs-mand-a; Natural Sciences, 1928, Shrii Gand-esha Prin't'in'ga Presa~, 212 pages. Barcode 2030020016325   Scan not available.

3193. San'skuuta Kal'aapuurnd-odaya  mallikaarjuna raavu; LANGUAGE. LINGUISTICS. LITERATURE, 1956, Not Available, 172 pages. Barcode 5010010042567   Scan not available.

3194. san'skuutamandiraanta praveshikaa  goopaalasuununaa raamakuushhnd-e; Religion, 1810, Nirnaya Sagar Press, Mumbai, 267 pages. Barcode 5010010087251   Scan not available.

3195. san'srxtavyaakarand-am  moniyara viliyams; Literature, 1895, Clarendon Press , Oxford, 428 pages. Barcode 5010010092098   Scan available.

3196. Sanaatana Vign-aana Samudaya  shriiveng-kat'aramand-aaryend-a; Language. Linguistics. Literature, 1946, beng-kaluuru presa, 630 pages. Barcode 5010010025913   Scan not available.

3197. Sanaatanadharmdiipikaa ,tasthaa , Bhaag Ii  s subrahmanya iyer; PHILOSOPHY. PSYCHOLOGY, 1921, pandit k t srinivasachariar , the dixon press, madras, 332 pages. Barcode 5010010078271   Scan available.

3198. Sanadaapatraan'tiila Maahitii  Chimnaajii Gand-esha; Geography. Biography. History, 1913, Jagadhitechu Presa~, 237 pages. Barcode 2030020016352   Scan not available.

3199. Sanathakumara Samhita  V.krishnamacharya; Unknown, 1969, -, 560 pages. Barcode 2020010007388   Scan available.

3200. Sanatsu Jatiya  Poonam Niraula; Rigveda Samhita, 1987, Krishnadas_Academy, 176 pages. Barcode 5010010007501   Scan not available.

3201. Sandesh Rasak  Hajari Prasad Divyedi; Unknown, 1960, HIDI GRANTH RATNAKA PRIVATE LIMITED, 244 pages. Barcode 2020010007394   Scan available.

3202. Sandhi Chandrika  Sri Ramachandra Jha Vyakarnacharya; Unknown, 1677, CHOUKHAMBA SANSKRIT SERIES OFFICE,VARANASI, 80 pages. Barcode 2020010013297   Server error, availability unknown.

3203. Sandhi Samasa Manjusha  Mathura Prasad; Atri Samhita, 1917, Sadasiva Dishit, 86 pages. Barcode 5010010001571   Server error, availability unknown.

3204. Sang-aameshar Krodamu  not availabe; Language. Linguistics. Literature, 1933, Not Available, 76 pages. Barcode 5010010024962   Scan not available.

3205. Sang-game Shrvarakrod'ama~  Gummaluura~yupanaamaka Sang-game Shrvarashaastrind-a; Language. Linguistics. Literature, 1933, Aandhravi Shrvakalaaparishhadaa, 82 pages. Barcode 2030020016310   Scan not available.

3206. Sangeetanjali  Pandit Omkarnath Thakur; Unknown, 1955, Indian Press, 230 pages. Barcode 2020010007404   Scan available.

3207. Sangeethgnan Ke Sansmar  vilayat hussian khan; The Arts, 1959, sangeet natak academy new delhi, 338 pages. Barcode 2020050058005   Scan not available.

3208. Sanghameswara Krodam  0000; Art, 0, K_Santa_Hyderabad, 72 pages. Barcode 5010010005622   Server error, availability unknown.

3209. Sangita Chandra  Suklapandita; Unknown, 1982, Sanskrit_Acadamy, 298 pages. Barcode 2020010007414   Scan available.

3210. Sangita Chandra (a Trearise On Indian Dance)  Suklapandita; Unknown, 1982, SANSKRIT ACADEMY, 180 pages. Barcode 2020010007413   Scan available.

3211. Sangitaratnakara Of Sarngadeva Vol 4 Adhyaya 7  pandit s subramanya shastri; Unknown, 1953, the adyar library, 638 pages. Barcode 2020010007415   Scan available.

3212. Sangitaratnakara Of Sarngadeva Vol I  Pandit S.subrahmanya Sastri; Art, 1943, The Vasanta Press Adyar Madras, 439 pages. Barcode 5010010005623   Server error, availability unknown.

3213. Sangitopanisat Saroddhara  vacanacharya sudhakalasa; Unknown, 1961, oriental insitute, 198 pages. Barcode 2020010007416   Scan available.

3214. Sangrahartha sangraha  Narayanacharya; Unknown, 1956, Majesticpress, Udipi, 131 pages. Barcode 5010010001576   Server error, availability unknown.

3215. Sanhit  Pandith Rajesh Dixit; Unknown, 1635, DEHATI PUSTAK BHANDAR, 650 pages. Barcode 2020010004570   Scan available.

3216. Sankalp Suryoday Vol I  Pandit Krishnama Charya; Unknown, 1948, ADYAR PUSTAKALAY, 644 pages. Barcode 2020010007421   Scan available.

3217. Sankara Bhashyalochanam  G.p.upadhaya; , 1947, , 377 pages. Barcode 5010010007509   Scan not available.

3218. Sankaravijaya  vyasacala; Language. Linguistics. Literature, 1954, government oriental manuscripts library madras, 264 pages. Barcode 2020050057986   Scan not available.

3219. Sankaravijaya  Vyasacala; Unknown, 1954, The Superintendent Government Press, 254 pages. Barcode 2020010007423   Scan available.

3220. Sankhya Darshan Ka Ethihas  Acharya Udhayveer Shastri; Unknown, 999, Virajanand_Vedic_Samsthan, 758 pages. Barcode 2020010007424   Scan available.

3221. Sankhya Darshan Pravachan Bhashya  Ramashankara Bhattacharya; Linguistics Literature, 1994, Bharatiya_Vidya_Prakashan, 352 pages. Barcode 5010010001579   Scan not available.

3222. Sankhya Karikas  isvara karikas; Language. Linguistics. Literature, 1955, sundari vilasa sanskrit patasala guntur, 86 pages. Barcode 2020050057955   Scan not available.

3223. Sankhya Sara  Vijnana Bhikshu; Philosophy. Psychology, 1606, Jibananda Vidyasagara, 48 pages. Barcode 5010010029975   Scan not available.

3224. Sankhyadarsana  Sri Vijnana Bhikshu; Unknown, 1987, CHAUKHAMBHA SANSKRIT SANSTHAN, 243 pages. Barcode 2020010013315   Server error, availability unknown.

3225. Sankhyayana Grihya Sangraha  G. Thibaut, Gopala Bhatta; , 1947, VIDYA VILLAS PRESS, BENNARAS, 107 pages. Barcode 5010010007510   Scan not available.

3226. Sankshepa Sarirakasya Adhyaya I  S.venkataramanan; Unknown, 1945, G.A.Natesan And Co.,Madras, 523 pages. Barcode 5010010001578   Server error, availability unknown.

3227. Sankshepa Sarirpaka  savanjatma muni; Language. Linguistics. Literature, 1913, haridas gupta and sons benares, 432 pages. Barcode 2020050036363   Scan not available.

3228. Sankskrutha Gantha Suchi  Unknown; Language. Linguistics. Literature, 999, Tmssm Library,Tanjavore, 467 pages. Barcode 5010010010723   Scan not available.

3229. Sankya Darshan  Pt.sriram Sharma Acharya; Unknown, 2002, SANSKRIT SANSTHAN, 266 pages. Barcode 2020010013318   Server error, availability unknown.

3230. Sansar Sagar Manthanam Vol Ii  Sree Purushottam Lal Srivastav; Unknown, 1963, APRAKHIL BHARATIYA SANSKRIT PARISHAD, 110 pages. Barcode 2020010007430   Scan available.

3231. Sanshipt Mahabharath Dritya Kand  vyasa; Religion. Theology, 0, geetha press gorakpur, 858 pages. Barcode 2020050058004   Scan not available.

3232. Sanskrit And ItsKindred Literatures  Poor Laura Elizabeth; PHILOSOPHY. PSYCHOLOGY, , , 515 pages. Barcode 2030020036898   Scan available.

3233. Sanskrit Bhasha Bhodhini Vol I I  Sri T K Tiruvenkatacharya; Unknown, 1959, SANSKRITH BHASHA PRACHARINI, 68 pages. Barcode 2020010007432   Scan available.

3234. Sanskrit Bhashamahe  -; Unknown, 999, SRI ARVINDANTHA RASHTRIYA SHIKSH KENDRAM, 102 pages. Barcode 2020010007433   Scan available.

3235. Sanskrit Drama Its Origin And Decline  I Shekhar; Unknown, 1960, LEIDEN, 260 pages. Barcode 2020010007434   Scan available.

3236. Sanskrit English Dictionary Vol 2  P K Gode; Unknown, 1958, PRASAD PRAKASHAN, 684 pages. Barcode 2020010007435   Scan available.

3237. Sanskrit Essentials Of Grammar And Language  Kurt F. Leidecker; Language. Linguistics. Literature, 1976, Adyar library and research center Madras, 150 pages. Barcode 5010010028235   Scan not available.

3238. Sanskrit Gadhy Padhy Sangraha Vol I  Sri Brahaspati Shastry; Unknown, 1953, CHOWKHAMBA SANSKRIT SERIES OFFICE, 118 pages. Barcode 2020010007437   Scan available.

3239. Sanskrit Gadya Padya Samgraha  Shri Brihaspati Shastri; Unknown, 1976, CHAUKHAMBHA SANSKRIT SERIES OFFICE, 207 pages. Barcode 2020010013321   Server error, availability unknown.

3240. Sanskrit Journal on Sahrudaya  K.krishnamachariar; Geography. Biography. History, 1886, Sri Vani Vilas Press,Srirangam, 435 pages. Barcode 5010010005632   Server error, availability unknown.

3241. Sanskrit Journal Sahrudaya Part 8  Krishnamachari; Unknown, 1994, SREE VANI VILAS PRESS, SRIRANGAM, 435 pages. Barcode 5010010001580   Scan not available.

3242. Sanskrit Manuscripts  Rangacharya; , 1911, THE SUPERITENDENT GOVT. PRESS, 376 pages. Barcode 5010010007512   Scan not available.

3243. Sanskrit Manuscripts 2  Not available; Religion. Theology, 0, Not available, 588 pages. Barcode 5010010024964   Scan not available.

3244. Sanskrit Manuscripts In The Adyar Library  F. Otto Schradee; , 1908, ORIENTAL PUBLISHERS CO. LTD., MADRAS, 323 pages. Barcode 5010010007513   Scan not available.

3245. Sanskrit Manuscripts Vol.ix  P.p.s. Sastri; Language. Linguistics. Literature, 1930, Sri Vani Vilas Press, Srirangam, 456 pages. Barcode 5010010024963   Scan not available.

3246. Sanskrit Nibandhavali  Hari Narayan Dikshit; Unknown, 1985, Eastern_Book_Linkers, 146 pages. Barcode 2020010007459   Scan available.

3247. Sanskrit Pravaahini Shabd Kosh  anjinyea murthi; Language. Linguistics. Literature, 1977, sanskrit pravaahini granda mala hyderabad, 370 pages. Barcode 2020050036354   Scan not available.

3248. Sanskrit Ratnakarmay Shigyandank  Pandit Vruddhi Chandra Sharma Shastri; Unknown, 1940, SRI GIRIDHAR SHARMA CHATURVAIDH PREM PRAKASH MUDRANALAY, 284 pages. Barcode 2020010007460   Scan available.

3249. Sanskrit Sahithyothihas Vol.1  Pro.hansraj Aggarwal; Unknown, 1651, Shakti Prakashan, 164 pages. Barcode 2020010007461   Scan available.

3250. Sanskrit Saiva Kavyas Vol I  Kanta Gupta; Unknown, 2002, Nag Publishers, Delhi, 667 pages. Barcode 5010010001582   Server error, availability unknown.

3251. Sanskrit Self Teacher Part 2  s d satwalekar; Language. Linguistics. Literature, 1971, satwalekar v s, 60 pages. Barcode 2020050057959   Scan not available.

3252. Sanskrit Sopanam Vol Iv  Surendra Kumar Gambhir; Unknown, 1980, PITAMBAR BOOK DEPOT, 146 pages. Barcode 2020010007462   Scan available.

3253. Sanskrit Studies  Hiriyanna M; LANGUAGE. LINGUISTICS. LITERATURE, 1954, Kavyalaya Publishers, 79 pages. Barcode 8000000000173   Scan available.

3254. Sanskrit Syntax And The Grammar Of Case  Brahmachari Surendra Kumar; Unknown, 1976, K.S.D.Sanskrit university, 302 pages. Barcode 2020010013326   Server error, availability unknown.

3255. Sanskrit Text Book For Detailed Study  -; Unknown, 1970, S V UNIVERSITY, 70 pages. Barcode 2020010007468   Scan available.

3256. Sanskrit Text Book For Detailed Study 1960  -; Unknown, 1960, SRI VENKATESHWARA UNIVERSITY, 62 pages. Barcode 2020010007463   Scan available.

3257. Sanskrit Text Book For Detailed Study 1962  -; Unknown, 1962, SRI VENKATESHWARA UNIVERSITY, 50 pages. Barcode 2020010007464   Scan available.

3258. Sanskrit Text Book For Detailed Study 1963  -; Unknown, 1963, SRI VENKATESHWARA UNIVERSITY, 44 pages. Barcode 2020010007465   Scan available.

3259. Sanskrit Text Book For Detailed Study 1964  -; Unknown, 999, SRI VENKATESHWARA UNIVERSITY, 42 pages. Barcode 2020010007466   Scan available.

3260. Sanskrit Text Book For Detailed Study 1967  -; Unknown, 1967, SRI VENKATESHWARA UNIVERSITY, 40 pages. Barcode 2020010007467   Scan available.

3261. Sanskrit Vyakaran Praveshika A Sanskrit Grammar For Students  Sri Rurthar M Mikanal; Unknown, 1843, Motilal_Banarasidas, 302 pages. Barcode 2020010013328   Server error, availability unknown.

3262. Sanskrit Vyakaranam  Pandit Ram chandra Jha; Unknown, 1996, Chowkhamba_vidyabhawan, 315 pages. Barcode 2020010013327   Server error, availability unknown.

3263.